[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49342.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.85.1
:199 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   28->96 1c89A PDBj 3e-04 9.1 %
:RPS:SCOP  30->96 1vliA1  b.85.1.1 * 1e-05 14.9 %
:HMM:PFM   54->96 PF08666 * SAF 3.1e-06 23.1 39/63  
:BLT:SWISS 8->171 DFA2_ANASP 6e-04 27.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49342.1 GT:GENE ABO49342.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 864668..865267 GB:FROM 864668 GB:TO 865267 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49342.1 GB:DB_XREF GI:134051371 LENGTH 199 SQ:AASEQ MKIKKHNIFYVLFVVFAVVTAIGVFHGYNTVTKKVPVAKAGADLVQDEMASSKNLVIGQTPIGALQKDTVRHPDEIKGMYAKGFIPAGTVLRKSMFISFKDAGVAARLANYPGKIAVSLGADIYTSVGGELKREYKVNIKSGYKGSEREIAKEAIVLSEPTAKKEAIVLAMTPEESTLLTSARSNNEKLTVQILPVKGD GT:EXON 1|1-199:0| BL:SWS:NREP 1 BL:SWS:REP 8->171|DFA2_ANASP|6e-04|27.4|164/100| TM:NTM 1 TM:REGION 10->32| RP:PDB:NREP 1 RP:PDB:REP 28->96|1c89A|3e-04|9.1|66/134| HM:PFM:NREP 1 HM:PFM:REP 54->96|PF08666|3.1e-06|23.1|39/63|SAF| RP:SCP:NREP 1 RP:SCP:REP 30->96|1vliA1|1e-05|14.9|67/72|b.85.1.1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 66 STR:RPRED 33.2 SQ:SECSTR ###########################ccccccccEEEEEcccccccccccTTTcEEEEccccccc###cccHHHHTTccccccccccEEccTTTc####################################################################################################### DISOP:02AL 1-3,199-200| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHccccEEEEcccccHHHHHccccHHHHccHHHccccccHHHHEEEEEEEEEcccHHHHHHccccEEEEEEccHHHHHccccEEEEEEEEEcccccccHHHHHHHHEEEcccccccEEEEEEEcccccEEEEEccccccEEEEEEEEEccc //