[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49346.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:328 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   68->114 PF03166 * MH2 0.00025 19.6 46/182  
:HMM:PFM   278->320 PF06086 * Pox_A30L_A26L 0.00052 28.6 42/220  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49346.1 GT:GENE ABO49346.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 867968..868954 GB:FROM 867968 GB:TO 868954 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49346.1 GB:DB_XREF GI:134051375 LENGTH 328 SQ:AASEQ MRHFFRIYKPCSKNDLFSTSIFEIIKTYFQIFIYKFSSIRVFGINQKCQRTHLYLPSSLPPIYTTTNTTYWNETKGIKHITSCKKTPNYHITKIFNTNRFIQQSENNKVNKQSNIGTKPRYNKTSKGQSQYIGMIRQIVGINRASRVTVGDCISSILVGFTPGIFLLVIIFTMYSHKLLLLSLKTNLFKIQEISKLYLLVTLSLFLIIVGICQLTNGLLVVSISRTLRNKNLYILYPKGRLLQVKVDKTWVLINFFVGTLCPVIIPTILWVIFFDIKIVNVKSGFLLFLLLCLVLNALHDNWNYIWEEQIKSNHTKFFLQQLNFRKYQ GT:EXON 1|1-328:0| TM:NTM 4 TM:REGION 157->179| TM:REGION 199->221| TM:REGION 251->273| TM:REGION 279->301| SEG 63->74|ytttnttywnet| SEG 177->189|kllllslktnlfk| SEG 286->298|llflllclvlnal| HM:PFM:NREP 2 HM:PFM:REP 68->114|PF03166|0.00025|19.6|46/182|MH2| HM:PFM:REP 278->320|PF06086|0.00052|28.6|42/220|Pox_A30L_A26L| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,103-126,326-329| PSIPRED cccHHHHHccccccccHHHHHHHHHHHHHHHHHEEEccEEEEEEcccEEEEEEEcccccccEEEEcccccccccccHHHHHHHccccccEEEEEEcccHHHHHccccccccccccccccccccccccHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHccHHHHHHHHHHHcccEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccEEEEEccccEEEEEEccEEEEHHHHHHHHHHHHHHHHHHHHHHEEEEEEEcccHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHcccccc //