[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49350.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:141 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   42->65 PF08523 * MBF1 0.00022 37.5 24/71  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49350.1 GT:GENE ABO49350.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 870541..870966 GB:FROM 870541 GB:TO 870966 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49350.1 GB:DB_XREF GI:134051379 LENGTH 141 SQ:AASEQ MVFLNRKTFALIAVFIFILGGGIGAMIDHYYYITIPQLNAMAEAQRQQEALNKAVRHGKVVEVKQQELTVAVTESGEETEKGKTITVTLTPRTNIQKGDLFLNRDGQVVDITQHLKPGIEVDLLVRGDKAMALYWEPGEEK GT:EXON 1|1-141:0| TM:NTM 1 TM:REGION 8->30| SEG 72->88|vtesgeetekgktitvt| HM:PFM:NREP 1 HM:PFM:REP 42->65|PF08523|0.00022|37.5|24/71|MBF1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 42-53,75-79,139-142| PSIPRED cEEEEccHHHHHHHHHHHHccHHHHHHEEEEEEEEccHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEEccccccccccEEEEEEccccccccccEEEcccccEEEEHHHcccccEEEEEEEcccEEEEEEcccccc //