[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49372.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->82 PF10694 * DUF2500 0.00035 23.0 74/110  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49372.1 GT:GENE ABO49372.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 891333..891584 GB:FROM 891333 GB:TO 891584 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49372.1 GB:DB_XREF GI:134051401 LENGTH 83 SQ:AASEQ MKNKTFIFITLFLILLSITVMMTGYLIKKDSINNSPSNIYTENQVSKAQRIVEYTRQDGQKVNLLVDFQKTDGGWKMTSMQVK GT:EXON 1|1-83:0| TM:NTM 1 TM:REGION 6->27| SEG 5->19|tfifitlflillsit| HM:PFM:NREP 1 HM:PFM:REP 7->82|PF10694|0.00035|23.0|74/110|DUF2500| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,83-84| PSIPRED ccccEEEHHHHHHHHHHHHHHHHHHEEEcccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEEEccccEEEEEEEEc //