[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49376.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:461 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   62->103 3e6bA PDBj 4e-04 21.4 %
:HMM:SCOP  46->117 1ft9A1 a.4.5.4 * 4.4e-05 22.2 %
:HMM:PFM   74->98 PF00325 * Crp 7.1e-05 52.0 25/32  
:REPEAT 2|159->182|183->206
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49376.1 GT:GENE ABO49376.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 895508..896893 GB:FROM 895508 GB:TO 896893 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49376.1 GB:DB_XREF GI:134051405 LENGTH 461 SQ:AASEQ MAKMTDLNEHIQEMINAGSTLVVEDLEEHCGYTRFSNVLLRNPDISELDKIVYGLIRSFAFGDKINAFPGQDRLAQYVGKRRETVNASLNRLKKHGLIDWIRRGMGETNVYIIKKLPDQMILEYINREAELEKQQEGKKTLASLMKDRSKELIQSNPTNVSLDAHPSINPLKSTDVCLDTHQDVSQNAHPLKKPVKSTNVRLDTHQTDVSLDTHHDVRLDAHKENKYKNTSIKRTTTTTKKDFLSKKKGDSDSSSTIEPDKQDLPSLVSEGNVVVVDNTSTTNLESKNSEKISDHENVVVALDKEGFTDEELEDAPVFDLPEELYSQSLWRNPPQRKPQEQKQKDAVQSEQKGIPQDLELEDIYKFIAMNFEVKVDQKFIKNLALKHWHKGGLEYFLNTVLAVIQFAENKKIRFEAVLTKALEKEWKPNNRVRSKDPFLCNNRTNDQADQRKRTLMRSMYS GT:EXON 1|1-461:0| NREPEAT 1 REPEAT 2|159->182|183->206| SEG 228->256|kntsikrtttttkkdflskkkgdsdssst| SEG 272->283|nvvvvdntsttn| SEG 333->344|ppqrkpqeqkqk| RP:PDB:NREP 1 RP:PDB:REP 62->103|3e6bA|4e-04|21.4|42/208| HM:PFM:NREP 1 HM:PFM:REP 74->98|PF00325|7.1e-05|52.0|25/32|Crp| HM:SCP:REP 46->117|1ft9A1|4.4e-05|22.2|72/80|a.4.5.4|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 15.4 SQ:SECSTR ################################################HHHHHHHcEEcccEEEEEccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEcccEEEEccHHHHHHHHTc###################################################################################################################################################################################################################################################################################################################################################### DISOP:02AL 1-7,129-143,241-261,283-292,330-355,446-449,461-462| PSIPRED cccHHHHHHHHHHHHccccEEEHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccEEEHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccHHHHHHHHHHHcccHHHcccHHccEEEEcccccEEccccccEEEccccccccccccEEEcccHHHHHHHHHHcccccccccccccHHHHHHHHccccEEEEEccccccccccccccccccccEEEEEccccccHHHHcccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHcccEEEEHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHc //