[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49377.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   34->69 PF05166 * YcgL 7e-05 38.2 34/74  
:HMM:PFM   6->39 PF01402 * RHH_1 0.00096 23.5 34/39  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49377.1 GT:GENE ABO49377.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 897377..897709 GB:FROM 897377 GB:TO 897709 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49377.1 GB:DB_XREF GI:134051406 LENGTH 110 SQ:AASEQ MSTSESFRLPKDLAGKLQSEAIRKHTTKTAVNIDALEYYFGKPEMVMAMAAFMASTELLAMAKKQDVKELRKGFITQARALLEVDRDDFHKAGQGQQKDHKSFGSGESPV GT:EXON 1|1-110:0| HM:PFM:NREP 2 HM:PFM:REP 34->69|PF05166|7e-05|38.2|34/74|YcgL| HM:PFM:REP 6->39|PF01402|0.00096|23.5|34/39|RHH_1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-8,91-103,105-111| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccc //