[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49381.1
DDBJ      :             TRAG family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  142/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:682 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   199->610 1e9sI PDBj 8e-23 12.7 %
:RPS:SCOP  458->610 1e9rA  c.37.1.11 * 1e-16 17.6 %
:HMM:SCOP  149->616 1e9rA_ c.37.1.11 * 2.9e-35 22.8 %
:RPS:PFM   199->541 PF02534 * TraG 1e-41 36.2 %
:RPS:PFM   574->675 PF04834 * Adeno_E3_14_5 1e-04 28.9 %
:HMM:PFM   194->617 PF02534 * TraG 1.5e-45 23.8 400/469  
:BLT:SWISS 199->657 VIRD4_RHIRD 3e-15 28.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49381.1 GT:GENE ABO49381.1 GT:PRODUCT TRAG family protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 899175..901223 GB:FROM 899175 GB:TO 901223 GB:DIRECTION + GB:PRODUCT TRAG family protein GB:NOTE PFAM: TRAG family protein KEGG: tte:TTE2042 ATPase involved in conjugal plasmid transfer GB:PROTEIN_ID ABO49381.1 GB:DB_XREF GI:134051410 InterPro:IPR003688 LENGTH 682 SQ:AASEQ MDWLKKGNAAMYLVLAVVFGALVLIFPVLALVFLCMMVAWWAGGKVLYTPAIVFVTAISLGLTAGYGMKCVQQVPRFDMSSGEWVKSDVQALSIRSWFSAKELSNPGNRAGRTGVLLGSLGGLGVAVAFKRRGKKRLHGPGIVQGRPVVKGGWGDEKEAAKICEFGPPKPGKYGGGVVLGKLNGRILRVIIGRMAIAAHTAIFGATGAGKTFGWVLPNIVSTAHDGWSMVISDPKGELVAGKWNASGEYEPGIADWLKKQGYEIIILNFKDPSQGSHRWNPLFEAKDDAEFRQVCEAMILSAGKENPFFAGGESNLFTALMGLTRYGSFLKDEMRHMRTVLSLLSWPVEKLDETFEKEYRSGQIPVYFYEKWRAAAGMFNNFATGVQSKVAVMTDGPLAALTAGHDINLLALSKKKTALFCILPTIGDLKPLLTAFYYLLFKRLVEYAEANNNRLPIPVRFILDEFANIGRIPNFSNRISFDRGLGICYNYIIQNRTQLNSLYGSDVAETFLGNTDIRMALRVNDDKTAGYFTRQLGSADVWDISERKDVTWPWKRMEITKKTESKKKLDLLYPWQFYEMEFYTAVVRVPTCRPFYLDTVAFSDLKEFKELSREPKTITDFAPAVPNHVPTPAIPSAEEEDEAPTPPKRQRKRKESHPDPAPDVASVLELNKGDDDIMRMFG GT:EXON 1|1-682:0| BL:SWS:NREP 1 BL:SWS:REP 199->657|VIRD4_RHIRD|3e-15|28.0|414/688| TM:NTM 2 TM:REGION 12->34| TM:REGION 46->68| SEG 13->24|lvlavvfgalvl| SEG 114->128|gvllgslgglgvava| SEG 166->184|gppkpgkygggvvlgklng| RP:PDB:NREP 1 RP:PDB:REP 199->610|1e9sI|8e-23|12.7|363/424| RP:PFM:NREP 2 RP:PFM:REP 199->541|PF02534|1e-41|36.2|323/431|TraG| RP:PFM:REP 574->675|PF04834|1e-04|28.9|97/104|Adeno_E3_14_5| HM:PFM:NREP 1 HM:PFM:REP 194->617|PF02534|1.5e-45|23.8|400/469|TraG| GO:PFM:NREP 4 GO:PFM GO:0009291|"GO:unidirectional conjugation"|PF02534|IPR003688| GO:PFM GO:0016020|"GO:membrane"|PF02534|IPR003688| GO:PFM GO:0009966|"GO:regulation of signal transduction"|PF04834|IPR008131| GO:PFM GO:0016021|"GO:integral to membrane"|PF04834|IPR008131| RP:SCP:NREP 1 RP:SCP:REP 458->610|1e9rA|1e-16|17.6|136/420|c.37.1.11| HM:SCP:REP 149->616|1e9rA_|2.9e-35|22.8|425/433|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 191 OP:NHOMOORG 142 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------1-----------------------------2-----------------------------------------------------1-------------------------------121--------------------------------------------------1---------------------1----------1-----------1-----1------1--5----------11111--1--------11----11---2-1-1-11-1-11-2111-1311-------11--2-1--231----1-112------3--1-------1151-422--1----------2-------1-433-11121--2--2-151----3-1--2-----------12-----11111111111111111111111111111--111-----1-----1-----11------1-------2---11--11222--1----------------------------------------------------------------------------------------------------------------------1------------1-----1-----1---11-----1---------------------------1--1-----------------------------------------------------------------1--11-------------------------1------------1----1----1-------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 413 STR:RPRED 60.6 SQ:SECSTR ######################################################################################################################################################################################################cEEEEccTTccHHHHHHHHHHHHHHTTcEEEEEEEETTHHHHHHEEEETTHHHHHHccTTcEEEcTTcEEEcTTcTTcTcTTcccccGGGGcccTTHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHTHHTcccHHHHHHHHHTccHHHHHHHTTTcTTTTTTcccHHHHHHHHHHcHHHHHHHHHHHHHHcHHHHHcccccccHHHHHHcTTcccEEEEEGGGHHHHHHHHHHHHHHHHHHGGGccccTTccEEEEEEEGGGccccccHHHHHHHcTTTTEEEEEEEccHHHHHHHHcHHHHHHHHTTccEEccccTTcHHHHHHHHHHHcEEEEEEEEcccEEc###EEEEEcccEEEEEEEEcccHHHHHTccTTEEEEEccccccEEEEEccccccccccccccc#################################################################### DISOP:02AL 1-1,4-6,135-148,541-569,614-639,644-665| PSIPRED ccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccHHHHccccccHHHcccHHHHHHHHcccccccccccccEEEEEccccccEEEcccccccEEEEEEEccccccHHHHHHHHHHHccccccEEEEEcccccHHHHHHHcccHHHHHHHHHHHHccccEEEEcccccccccEEEcHHHHcccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccHHHHccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEccHHcccHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHcHHHHHHHHHHccEEEEEccccHHHHHHHHHHHccEEEEEEEEEEcccccccccccccEEEEEEEEccccHHHHHHccccEEEEEEcccccEEEEEccccccHHHHHHHcccccccccccccccccccccHHHcccccccccccHHHHHHHHccccccccHHcccccccccHHHHHHcc //