[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49386.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:113 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->42 PF09102 * Exotox-A_target 0.00011 30.3 33/143  
:HMM:PFM   75->103 PF05510 * Sarcoglycan_2 0.00079 27.6 29/400  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49386.1 GT:GENE ABO49386.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 904922..905263 GB:FROM 904922 GB:TO 905263 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49386.1 GB:DB_XREF GI:134051415 LENGTH 113 SQ:AASEQ MTPNTTSNLGGDLGELAESNPLSMERVLTMVREENGTYVYKNHKTLHYRLNQFKAGFKLKVSTRILVNLERVRRTLAITGLVFAIVTVVLSKVIFFFTKAIRQRLISKLLAWL GT:EXON 1|1-113:0| TM:NTM 1 TM:REGION 75->97| HM:PFM:NREP 2 HM:PFM:REP 10->42|PF09102|0.00011|30.3|33/143|Exotox-A_target| HM:PFM:REP 75->103|PF05510|0.00079|27.6|29/400|Sarcoglycan_2| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,6-6| PSIPRED cccccccccccHHHHHHccccccHHHHHHHHHHccccEEEEcccHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //