[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49392.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:243 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   172->195 PF12224 * Amidoligase_2 0.00097 45.8 24/252  
:HMM:PFM   132->158 PF07110 * EthD 0.00079 37.0 27/103  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49392.1 GT:GENE ABO49392.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 910655..911386 GB:FROM 910655 GB:TO 911386 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49392.1 GB:DB_XREF GI:134051421 LENGTH 243 SQ:AASEQ MLKIKGMNIPRIKCVGCGAEIPEGMACGYCLGLLDEPKDYNYHSFEVVGNRRKNARSNIWGFGVEIETLSTSPKQLVLLKKGFTPCYDSSVTLEWKSPIFQSLVGFKGICKMIEKMDVEHGGSHVHISVKRKDLFEDYYKEIFYPLAEYLDGSAYYRIWGRQDNDYCELPGYPDSRYSWVNVQTKYNTVEWRLPKFLNAKQYYELVKWLINITWAVDNKLMKNQRPGDVGQWILRTYQEQMAA GT:EXON 1|1-243:0| HM:PFM:NREP 2 HM:PFM:REP 172->195|PF12224|0.00097|45.8|24/252|Amidoligase_2| HM:PFM:REP 132->158|PF07110|0.00079|37.0|27/103|EthD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,4-6,241-244| PSIPRED ccEEccccccEEEEEEcccccccccHHHHHHHHcccccccccEEEEEEEccccccccccEEEEEEEEEEcccccEEEEEEcccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccEEEEEEEEEEEEEEEEcHHHHcHHHHHHHHHHHHHHHEEEcHHHHccccccHHHHHHHHHHHHHHcc //