[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49398.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:135 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   60->133 PF04473 * DUF553 0.00056 29.5 44/153  
:HMM:PFM   37->72 PF11510 * FA_FANCE 0.00081 37.1 35/263  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49398.1 GT:GENE ABO49398.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 916276..916683 GB:FROM 916276 GB:TO 916683 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49398.1 GB:DB_XREF GI:134051427 LENGTH 135 SQ:AASEQ MNSDPFRLAQQGSSQENNVMKTTNLYKGAVAFPLFLASMDSQDDLQVSVVASYQSNVKNMVESSLTSVKSFAGNSITYTYEKEETQIGDCSYTRAIRLIKVVSTFGETAEIVYKDKEAFECIWPHYSKSSKNDFG GT:EXON 1|1-135:0| HM:PFM:NREP 2 HM:PFM:REP 60->133|PF04473|0.00056|29.5|44/153|DUF553| HM:PFM:REP 37->72|PF11510|0.00081|37.1|35/263|FA_FANCE| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,8-19,129-136| PSIPRED ccccHHHHHHccccccccEEEEcccccccHHHHHHHHHccccccEEEEEEEEHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHHHHcccEEEEEEccccEEEcccccccccccccc //