[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49399.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->51 2aevA PDBj 9e-04 35.4 %
:HMM:PFM   19->60 PF05089 * NAGLU 0.0004 28.2 39/671  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49399.1 GT:GENE ABO49399.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(916776..917027) GB:FROM 916776 GB:TO 917027 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49399.1 GB:DB_XREF GI:134051428 LENGTH 83 SQ:AASEQ MNFNKKNRHALHIEMNSGNRYILTSKDADFLNRASTFIAETINHYGLEGQGDHYYIDFSNHVIKNESGVVNTGYIGGEISNEK GT:EXON 1|1-83:0| BL:PDB:NREP 1 BL:PDB:REP 4->51|2aevA|9e-04|35.4|48/365| HM:PFM:NREP 1 HM:PFM:REP 19->60|PF05089|0.0004|28.2|39/671|NAGLU| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 48 STR:RPRED 57.8 SQ:SECSTR ###HHTcGGGcEEcccccccccccHHHHHHTTcHHHHHHHHHHHHHHHHHT################################ DISOP:02AL 1-6,80-84| PSIPRED cccccccEEEEEEEEccccEEEEEcccHHHHHHHHHHHHHHHcccccEEcccEEEEEccEEEEccccccccccEEccEEEccc //