[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49404.1
DDBJ      :             transposase, IS204/IS1001/IS1096/IS1165 family protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  160/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
a.74.1
:434 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  74->152 1c9bA2  a.74.1.2 * 2e-05 19.7 %
:RPS:PFM   147->240 PF01610 * Transposase_12 1e-15 38.3 %
:HMM:PFM   146->239 PF01610 * Transposase_12 7.9e-30 41.5 94/100  
:BLT:SWISS 22->369 TNPA_BORPA 3e-20 24.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49404.1 GT:GENE ABO49404.1 GT:PRODUCT transposase, IS204/IS1001/IS1096/IS1165 family protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 921260..922564 GB:FROM 921260 GB:TO 922564 GB:DIRECTION + GB:PRODUCT transposase, IS204/IS1001/IS1096/IS1165 family protein GB:NOTE PFAM: transposase, IS204/IS1001/IS1096/IS1165 family protein KEGG: msu:MS1646 hypothetical protein GB:PROTEIN_ID ABO49404.1 GB:DB_XREF GI:134051433 InterPro:IPR002560 LENGTH 434 SQ:AASEQ MDILNLPHFKVLHVEQTEHDYSIRAEMASPPIICPNCYNRDFVGYGKKEQLFMDLPIHGKRVGILVNRRRYRCKECNKTFLEILPDMDEKRLATTRLIEYVQKQSLKRTFASISEDVGLDEKTVRNIFRDYVTHLEKTVRFATPEYLGIDEIHIIHPRCVVCNVKDRTIINILQNRNKETVIKYLMELPDRDRVKYVSMDMWQPYRDAVKLVLPQAKIIVDKFHVLRMANQGVETVRKDIRANMTPKQRRTLMHDRFVLLKRRHELKEAEFLKLESWTKNLPDLGKAYELKEEFFQVYESKNQAEAIERYNAWLSKVTDEICFAFEPLIKALTNWHHEVFNYFNHPITNAYTEALNGLIRVMNRLGRGYSFEALRAKILFTEGLSKSKRPLYRRQNREPIMSRMVIAETTIDYQNWDTGVPITTLVDFIEKGKI GT:EXON 1|1-434:0| BL:SWS:NREP 1 BL:SWS:REP 22->369|TNPA_BORPA|3e-20|24.2|347/406| RP:PFM:NREP 1 RP:PFM:REP 147->240|PF01610|1e-15|38.3|94/100|Transposase_12| HM:PFM:NREP 1 HM:PFM:REP 146->239|PF01610|7.9e-30|41.5|94/100|Transposase_12| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF01610|IPR002560| GO:PFM GO:0004803|"GO:transposase activity"|PF01610|IPR002560| GO:PFM GO:0006313|"GO:transposition, DNA-mediated"|PF01610|IPR002560| RP:SCP:NREP 1 RP:SCP:REP 74->152|1c9bA2|2e-05|19.7|76/109|a.74.1.2| OP:NHOMO 787 OP:NHOMOORG 164 OP:PATTERN -------------------------------------------------221---------------- --2-1---34-----------7----------------2-------23--------4-----------------------1----------2---------------1------------------3E-A13-1------------F44-5-d-------------1-53----------------------1-----------------e-------95A-8-----------A8---262288A221--Q---1-8216-M--832---H-------2---354-117--5262B-4--------------11135H111--1---------------------B----1--1----1----1--4-1-2---1-------------------------------------------------------------------------22222222--------------------------------------1------M------1--FDED---1654-69-17124---1-2---5---5------------------------------A11---------16P-12-------C--------------------------------3--2-----1----1-1-3----2-2----1-1------------------1-------------6----------31----1---------1--------------------------------------1655-2--------1---------2-1-21--------------D---13----------------------1----1--------1--------------------------------------------------8-1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------1------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 386-403,434-435| PSIPRED cccccccccEEEEEEEcccEEEEEEEEccccccccccccccEEEccccEEEEEEcccccEEEEEEEEEEEEEEccccEEEEEEcccccccccccHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccEEEEEEcccccEEEEEccccHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccHHHHcccHHHccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccEEcccccccccccccHHHHccccccccccccccccccHHHHHHHHHcccc //