[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49408.1
DDBJ      :             NERD domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:273 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   107->196 PF08378 * NERD 1e-04 28.9 %
:HMM:PFM   85->200 PF08378 * NERD 3.2e-31 31.9 116/125  
:BLT:SWISS 73->180 Y6003_BACAN 8e-06 34.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49408.1 GT:GENE ABO49408.1 GT:PRODUCT NERD domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(929836..930657) GB:FROM 929836 GB:TO 930657 GB:DIRECTION - GB:PRODUCT NERD domain protein GB:NOTE PFAM: NERD domain protein GB:PROTEIN_ID ABO49408.1 GB:DB_XREF GI:134051437 InterPro:IPR011528 LENGTH 273 SQ:AASEQ MFKKYISNSYLKKFSFLTILWLALTASGVVLLFYGAISILSFLFSSNHSLLELIVTSSLAFIGLPLGWFHFHIAKHLKKYISTQKKGWEGEQLFYKLDSLNIKHKRLTDLDLITPDGEKSQIDALIILPKVVICVEIKNRASYYVDKDGKWYSLKFKKWVNTRSPIAQNEYHCKFIKSLLYNNGFSTDVWSLVVLTDPRGEYRLENLKVPHKTKLITLDEVGKTIYEISSSSKVDTFLNLDSIENTILKYQEPFDFEKTIKKELGYFIKYLIE GT:EXON 1|1-273:0| BL:SWS:NREP 1 BL:SWS:REP 73->180|Y6003_BACAN|8e-06|34.0|103/100| TM:NTM 2 TM:REGION 17->39| TM:REGION 51->73| SEG 37->53|isilsflfssnhsllel| RP:PFM:NREP 1 RP:PFM:REP 107->196|PF08378|1e-04|28.9|90/121|NERD| HM:PFM:NREP 1 HM:PFM:REP 85->200|PF08378|3.2e-31|31.9|116/125|NERD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,6-6| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccEEEEEEcccccEEEccccEEEEEEEEEcccEEEEEEEEEccEEEEccccEEEEEEccEEcccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEEccccEEEEcccccccEEEEEEHHHHHHHHHHHHcccccccEEHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHc //