[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49413.1
DDBJ      :             transposase IS200-family protein
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  175/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.58.57
:133 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->130 2ec2F PDBj 2e-30 46.1 %
:RPS:PDB   1->130 2ec2A PDBj 2e-31 46.1 %
:RPS:SCOP  1->131 2a6mA1  d.58.57.1 * 8e-30 28.9 %
:HMM:SCOP  1->132 2a6oA1 d.58.57.1 * 1.5e-41 41.9 %
:RPS:PFM   15->129 PF01797 * Transposase_17 6e-21 35.7 %
:HMM:PFM   11->130 PF01797 * Transposase_17 9e-47 43.3 120/121  
:BLT:SWISS 7->130 T200_SALTY 9e-17 30.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49413.1 GT:GENE ABO49413.1 GT:PRODUCT transposase IS200-family protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(936855..937256) GB:FROM 936855 GB:TO 937256 GB:DIRECTION - GB:PRODUCT transposase IS200-family protein GB:NOTE PFAM: transposase IS200-family protein KEGG: hma:rrnAC0815 probable transposase GB:PROTEIN_ID ABO49413.1 GB:DB_XREF GI:134051442 InterPro:IPR002686 LENGTH 133 SQ:AASEQ MKTNATSHSRYNINYHLVWCPKYRHQVLTDQIETYLKKLIYNICDHYKYEVLTMEVMPDYIHLFVSVKPYVSPTEVVKTIKSITAVWIFKKFPNLKKRKFWGSGLWSKGYYVGTAGPVSAETIQKYIENQKLV GT:EXON 1|1-133:0| BL:SWS:NREP 1 BL:SWS:REP 7->130|T200_SALTY|9e-17|30.3|122/152| BL:PDB:NREP 1 BL:PDB:REP 1->130|2ec2F|2e-30|46.1|128/129| RP:PDB:NREP 1 RP:PDB:REP 1->130|2ec2A|2e-31|46.1|128/130| RP:PFM:NREP 1 RP:PFM:REP 15->129|PF01797|6e-21|35.7|115/119|Transposase_17| HM:PFM:NREP 1 HM:PFM:REP 11->130|PF01797|9e-47|43.3|120/121|Transposase_17| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF01797|IPR002686| GO:PFM GO:0004803|"GO:transposase activity"|PF01797|IPR002686| GO:PFM GO:0006313|"GO:transposition, DNA-mediated"|PF01797|IPR002686| RP:SCP:NREP 1 RP:SCP:REP 1->131|2a6mA1|8e-30|28.9|128/130|d.58.57.1| HM:SCP:REP 1->132|2a6oA1|1.5e-41|41.9|129/0|d.58.57.1|1/1|Transposase IS200-like| OP:NHOMO 1186 OP:NHOMOORG 199 OP:PATTERN --1---1-7224--17--------24431193------------------1GE-----1-1-12---- ---------------------2----------1------1--34-----------------------1--2----1-----1-----1--------8----1-1----2------------------------3--9-------1-32A-743E1----------4-17---------------19-------------5------11238-------51--13-------3-------1-11---11-322-1------A--1--JJ---3-----------22----2-----1--1---------------4411-222-33-1------1--3-9111-2-A-32-3----332C12--21----1--3--1--------------1---1---------------------------------4------------1---------------1--------------------------B-----------------------------------------------------------1--------------------1--4---4-----1-1-----------3-1-------------------3-7----------1------1-1--128-2-----24--------9--32-----------------21H-1-111-1---1821-2216---------1--8C7--7----4--R6R7----1------3*rl5***uF2E------------------------------24-------------------------------------------P47447---------------------1----------1--1--------------------------------3-313-2--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 98.5 SQ:SECSTR cccEEccccEEccEEEEEEcccccTTcccTHHHHHHHHHHHHHHHHHTcEEEEEEEETTEEEEEEEccTTccHHHHHHHHHHHHHHHHHHTTHHHHHTccTTccccccccEEEEEccccHHHHHHHHHHcH## DISOP:02AL 1-3,131-134| PSIPRED ccccccccEEEEEEEEEEEEEccccHHcHHHHHHHHHHHHHHHHHHcccEEEEEEEcccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcccccHHHHHHHHHHcccc //