[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49417.1
DDBJ      :             protein of unknown function DUF955
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->113 3dteA PDBj 4e-08 21.8 %
:HMM:PFM   10->112 PF06114 * DUF955 3.9e-16 25.8 93/122  
:BLT:SWISS 1->111 YIM2_BPPH1 7e-04 25.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49417.1 GT:GENE ABO49417.1 GT:PRODUCT protein of unknown function DUF955 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(941217..941564) GB:FROM 941217 GB:TO 941564 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF955 GB:NOTE PFAM: protein of unknown function DUF955 KEGG: cpf:CPF_1607 hypothetical protein GB:PROTEIN_ID ABO49417.1 GB:DB_XREF GI:134051446 InterPro:IPR010359 LENGTH 115 SQ:AASEQ MGYIKNDNGEAFILLNAKLRTDPVLYLCTMAEEIGHHITKAKSNILAKDYSLITITLAKSLNMAIDELKARIWAVNFLIPDEEFKKLTKYKLTNSELASYFKVTEEFIEIKWQLL GT:EXON 1|1-115:0| BL:SWS:NREP 1 BL:SWS:REP 1->111|YIM2_BPPH1|7e-04|25.7|101/158| RP:PDB:NREP 1 RP:PDB:REP 7->113|3dteA|4e-08|21.8|101/241| HM:PFM:NREP 1 HM:PFM:REP 10->112|PF06114|3.9e-16|25.8|93/122|DUF955| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------1------1--------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 93.9 SQ:SECSTR ######ETTTTEEEEETTcc#cHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccHHHHHHHHTccHHHHHHHHHTT DISOP:02AL 1-1,4-7| PSIPRED cccEEcccccEEEEEEcccccccEEHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEHHHHHHHHHHHHHHEEEEEEccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHEEEEc //