[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49426.1
DDBJ      :             transcriptional regulator, XRE family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:77 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->69 1b0nA PDBj 1e-08 35.9 %
:RPS:PDB   6->69 2axuD PDBj 4e-13 29.5 %
:RPS:SCOP  6->69 1b0nA2  a.35.1.3 * 2e-13 35.9 %
:HMM:SCOP  1->71 2bnmA1 a.35.1.3 * 7.1e-15 46.5 %
:RPS:PFM   12->65 PF01381 * HTH_3 5e-05 50.9 %
:HMM:PFM   12->65 PF01381 * HTH_3 5.8e-20 52.8 53/55  
:BLT:SWISS 6->77 SINR_BACSU 2e-08 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49426.1 GT:GENE ABO49426.1 GT:PRODUCT transcriptional regulator, XRE family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 948862..949095 GB:FROM 948862 GB:TO 949095 GB:DIRECTION + GB:PRODUCT transcriptional regulator, XRE family GB:NOTE PFAM: helix-turn-helix domain protein KEGG: mmo:MMOB3450 adenine-specific DNA methyltransferase GB:PROTEIN_ID ABO49426.1 GB:DB_XREF GI:134051455 InterPro:IPR001387 LENGTH 77 SQ:AASEQ MLLMGIGENVIKLREAKNWSQQDLEEASKVPQSSISRIEKGLLRNPGVETVRKLATALNVSVAELLEEETSAKAVGE GT:EXON 1|1-77:0| BL:SWS:NREP 1 BL:SWS:REP 6->77|SINR_BACSU|2e-08|33.3|72/111| BL:PDB:NREP 1 BL:PDB:REP 6->69|1b0nA|1e-08|35.9|64/103| RP:PDB:NREP 1 RP:PDB:REP 6->69|2axuD|4e-13|29.5|61/294| RP:PFM:NREP 1 RP:PFM:REP 12->65|PF01381|5e-05|50.9|53/55|HTH_3| HM:PFM:NREP 1 HM:PFM:REP 12->65|PF01381|5.8e-20|52.8|53/55|HTH_3| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 1 RP:SCP:REP 6->69|1b0nA2|2e-13|35.9|64/68|a.35.1.3| HM:SCP:REP 1->71|2bnmA1|7.1e-15|46.5|71/0|a.35.1.3|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 75 STR:RPRED 97.4 SQ:SECSTR HHcccHHHHHHHHHHHTTccHHHHHTHTTTcHHHHHHHHHTTcccccHHHHHHHHHHHTccHHHHHHTTTcccEE## DISOP:02AL 70-78| PSIPRED cHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHccccHHHHHcc //