[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49435.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:235 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   99->229 3ievA PDBj 5e-04 31.1 %
:RPS:PDB   74->223 3a1uB PDBj 5e-04 16.7 %
:RPS:SCOP  112->213 2p67A1  c.37.1.10 * 2e-05 24.7 %
:HMM:SCOP  2->224 1lnzA2 c.37.1.8 * 4.7e-06 22.0 %
:RPS:PFM   95->143 PF12449 * DUF3684 8e-04 36.2 %
:HMM:PFM   64->193 PF02492 * cobW 2.3e-07 17.7 130/173  
:BLT:SWISS 35->119 UVRB_SYMTH 2e-04 32.9 %
:BLT:SWISS 164->217 ERA_CLOBL 2e-05 35.2 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49435.1 GT:GENE ABO49435.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 959118..959825 GB:FROM 959118 GB:TO 959825 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49435.1 GB:DB_XREF GI:134051464 LENGTH 235 SQ:AASEQ MGKSTILGELYKGLKNRNHQPLAVGSGVQDEKPYLHKGIDPSYLTIAVPDPGRDIASDIDRVIRNAVNQIKEKNKLIESARKALEELNKVRSVLELGNLSQKDIPKTTTLPDVVLIEAVGINDGYKAEECRKLADVLVTIIPAGLKGEIIMDAGNFLLDEADILVVTKIDETPRDVTSTTLKLLQRIYRTKPIIPVVATKGVHMNLVLDEVIKGMAEPMILFDPIMPEETSKRIN GT:EXON 1|1-235:0| BL:SWS:NREP 2 BL:SWS:REP 35->119|UVRB_SYMTH|2e-04|32.9|85/659| BL:SWS:REP 164->217|ERA_CLOBL|2e-05|35.2|54/296| COIL:NAA 40 COIL:NSEG 1 COIL:REGION 56->95| BL:PDB:NREP 1 BL:PDB:REP 99->229|3ievA|5e-04|31.1|122/302| RP:PDB:NREP 1 RP:PDB:REP 74->223|3a1uB|5e-04|16.7|144/246| RP:PFM:NREP 1 RP:PFM:REP 95->143|PF12449|8e-04|36.2|47/1060|DUF3684| HM:PFM:NREP 1 HM:PFM:REP 64->193|PF02492|2.3e-07|17.7|130/173|cobW| RP:SCP:NREP 1 RP:SCP:REP 112->213|2p67A1|2e-05|24.7|93/301|c.37.1.10| HM:SCP:REP 2->224|1lnzA2|4.7e-06|22.0|168/185|c.37.1.8|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 66.4 SQ:SECSTR #########################################################################HHHHTcccEEcccEEccEEEEEETTEEEEEcccccccccccHHHHHHHHHHHHccHHHHHccEEEEEEETTccHHHHHHHHHHHTTccEEEEEEcHHHHHHTTccccHHHHHHHHHcccEEEccTTTcTTHHHHHHHHHHHHTcccccccccccTT###### DISOP:02AL 1-3,229-236| PSIPRED cccHHHHHHHHHHHHccccccccccccccccccHHHcccccHHEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHccccccEEEEEcccEEEccccEEEEEEcccccHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHHHcccEEEEcccccHHHHHccc //