[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49439.1
DDBJ      :             helix-turn-helix domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  57/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:255 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->64 1b0nA PDBj 7e-09 41.7 %
:BLT:PDB   74->133 1b0nA PDBj 1e-07 41.0 %
:BLT:PDB   139->193 1b0nA PDBj 6e-06 37.5 %
:RPS:PDB   5->70 2b5aA PDBj 7e-13 30.3 %
:RPS:PDB   74->134 3dnvB PDBj 3e-12 26.2 %
:RPS:PDB   139->241 2axuD PDBj 7e-14 17.8 %
:RPS:SCOP  5->66 1utxA  a.35.1.3 * 5e-13 22.6 %
:RPS:SCOP  74->137 1x57A1  a.35.1.12 * 7e-12 21.9 %
:RPS:SCOP  139->202 1y9qA1  a.35.1.8 * 2e-12 32.8 %
:HMM:SCOP  1->70 2b5aA1 a.35.1.3 * 2e-15 42.9 %
:HMM:SCOP  74->138 1y9qA1 a.35.1.8 * 1e-14 50.8 %
:HMM:SCOP  139->210 1x57A1 a.35.1.12 * 1.4e-15 43.1 %
:RPS:PFM   8->62 PF01381 * HTH_3 5e-07 49.1 %
:RPS:PFM   78->127 PF01381 * HTH_3 4e-06 44.0 %
:RPS:PFM   143->193 PF01381 * HTH_3 2e-07 54.9 %
:HMM:PFM   8->60 PF01381 * HTH_3 1.7e-18 41.5 53/55  
:HMM:PFM   78->130 PF01381 * HTH_3 3.8e-16 45.3 53/55  
:HMM:PFM   143->197 PF01381 * HTH_3 7.3e-17 45.5 55/55  
:BLT:SWISS 5->66 RPC_BPPH1 3e-09 43.5 %
:BLT:SWISS 74->136 RPC_BPPH1 3e-10 42.9 %
:BLT:SWISS 133->214 PUUR_SHIFL 8e-11 39.0 %
:REPEAT 3|5->63|75->133|140->198

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49439.1 GT:GENE ABO49439.1 GT:PRODUCT helix-turn-helix domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 964055..964822 GB:FROM 964055 GB:TO 964822 GB:DIRECTION + GB:PRODUCT helix-turn-helix domain protein GB:NOTE PFAM: helix-turn-helix domain protein KEGG: chy:CHY_0550 transcriptional regulator, AraC family GB:PROTEIN_ID ABO49439.1 GB:DB_XREF GI:134051468 InterPro:IPR001387 LENGTH 255 SQ:AASEQ MIVRGDQIRALREERGYTLQDLARRAKLSLSYLSEIERGSKRPSLKTIDKLAAALNVSKTQLVEGEITDSGLGLGEKIRIIRNETGLSLQELADKIGISLSYLSEIERGTVYPALNTLKRVAEGLGVPATALMGHEGSLGYKLKHLREEYGLTQAQLANLAGVTAGLIGQIEQGKVQPSLKTLEKLSEVMGVSPCYFIMEPGAVDQMVSLMNPELRELLIHPNVQAVLGLVCNLNEKELQFILNFIQLFKKSELS GT:EXON 1|1-255:0| BL:SWS:NREP 3 BL:SWS:REP 5->66|RPC_BPPH1|3e-09|43.5|62/144| BL:SWS:REP 74->136|RPC_BPPH1|3e-10|42.9|63/144| BL:SWS:REP 133->214|PUUR_SHIFL|8e-11|39.0|82/185| NREPEAT 1 REPEAT 3|5->63|75->133|140->198| BL:PDB:NREP 3 BL:PDB:REP 5->64|1b0nA|7e-09|41.7|60/103| BL:PDB:REP 74->133|1b0nA|1e-07|41.0|60/103| BL:PDB:REP 139->193|1b0nA|6e-06|37.5|55/103| RP:PDB:NREP 3 RP:PDB:REP 5->70|2b5aA|7e-13|30.3|66/77| RP:PDB:REP 74->134|3dnvB|3e-12|26.2|61/71| RP:PDB:REP 139->241|2axuD|7e-14|17.8|101/294| RP:PFM:NREP 3 RP:PFM:REP 8->62|PF01381|5e-07|49.1|55/55|HTH_3| RP:PFM:REP 78->127|PF01381|4e-06|44.0|50/55|HTH_3| RP:PFM:REP 143->193|PF01381|2e-07|54.9|51/55|HTH_3| HM:PFM:NREP 3 HM:PFM:REP 8->60|PF01381|1.7e-18|41.5|53/55|HTH_3| HM:PFM:REP 78->130|PF01381|3.8e-16|45.3|53/55|HTH_3| HM:PFM:REP 143->197|PF01381|7.3e-17|45.5|55/55|HTH_3| GO:PFM:NREP 3 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 3 RP:SCP:REP 5->66|1utxA|5e-13|22.6|62/66|a.35.1.3| RP:SCP:REP 74->137|1x57A1|7e-12|21.9|64/78|a.35.1.12| RP:SCP:REP 139->202|1y9qA1|2e-12|32.8|64/79|a.35.1.8| HM:SCP:REP 1->70|2b5aA1|2e-15|42.9|70/0|a.35.1.3|1/3|lambda repressor-like DNA-binding domains| HM:SCP:REP 74->138|1y9qA1|1e-14|50.8|65/0|a.35.1.8|2/3|lambda repressor-like DNA-binding domains| HM:SCP:REP 139->210|1x57A1|1.4e-15|43.1|72/0|a.35.1.12|3/3|lambda repressor-like DNA-binding domains| OP:NHOMO 65 OP:NHOMOORG 57 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------------1---1----------1-------------------------------------------------------------------------------------------------------1----------------11------------11--111---13--------------------------------------------------------11--------1---------------------------------------------------------1-21-----------------------------------------------------6------------------------1----------------------11-1---------------------------------------------------------------------------1-----111-1---11-11111--1111-111111--------------------------11111-1----------------------------------------------------------------------------------------------------------------------11----------------------------------------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 253 STR:RPRED 99.2 SQ:SECSTR cccHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHTTcccccHHHHHHHHHHTTccHHHHHHHHHHccHHHHHTcHHHHHHHTTccHHHHHHHHTccHHHHHHHHHcGGGccHHHHHHHHHHTTccccccccccccHHHHHHHHHHHTTccHHHHHTHTTTcHHHHHHHHHTcccccHHHHHHHHHHHTccHHHHHHTTTccccHHHHHHHHHHHHHTcGGGHHHHHHHHGGGTTccHHHHHHHHHHHHHH## DISOP:02AL 255-256| PSIPRED cHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcc //