[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49440.1
DDBJ      :             thioredoxin
Swiss-Prot:             

Homologs  Archaea  38/68 : Bacteria  883/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:105 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   15->105 1nw2A PDBj 2e-28 58.2 %
:RPS:PDB   14->105 2eiqA PDBj 7e-24 46.7 %
:RPS:SCOP  20->105 1qgvA  c.47.1.8 * 7e-23 12.8 %
:HMM:SCOP  2->107 2trcP_ c.47.1.6 * 6.3e-40 49.0 %
:RPS:PFM   14->97 PF00085 * Thioredoxin 7e-28 61.9 %
:HMM:PFM   4->102 PF00085 * Thioredoxin 3.2e-36 50.5 99/104  
:BLT:SWISS 14->101 THIO1_ANASP 3e-29 58.0 %
:PROS 22->40|PS00194|THIOREDOXIN_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49440.1 GT:GENE ABO49440.1 GT:PRODUCT thioredoxin GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 964949..965266 GB:FROM 964949 GB:TO 965266 GB:DIRECTION + GB:PRODUCT thioredoxin GB:NOTE TIGRFAM: thioredoxin PFAM: Redoxin domain protein; Thioredoxin domain KEGG: sth:STH2404 thioredoxin GB:PROTEIN_ID ABO49440.1 GB:DB_XREF GI:134051469 InterPro:IPR005746 InterPro:IPR006662 InterPro:IPR013740 InterPro:IPR013766 LENGTH 105 SQ:AASEQ MALELNAANFEAEVLKSDIPVLVDFWAAWCGPCRAIAPVVEQLSTEYAGKVKVGKVNVDENRELAQQFGVMSIPTLIFLKNGEKVDQVIGFTGKADLEKKLNAIL GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 14->101|THIO1_ANASP|3e-29|58.0|88/107| PROS 22->40|PS00194|THIOREDOXIN_1|PDOC00172| SEG 2->13|alelnaanfeae| BL:PDB:NREP 1 BL:PDB:REP 15->105|1nw2A|2e-28|58.2|91/105| RP:PDB:NREP 1 RP:PDB:REP 14->105|2eiqA|7e-24|46.7|92/107| RP:PFM:NREP 1 RP:PFM:REP 14->97|PF00085|7e-28|61.9|84/103|Thioredoxin| HM:PFM:NREP 1 HM:PFM:REP 4->102|PF00085|3.2e-36|50.5|99/104|Thioredoxin| GO:PFM:NREP 1 GO:PFM GO:0045454|"GO:cell redox homeostasis"|PF00085|IPR013766| RP:SCP:NREP 1 RP:SCP:REP 20->105|1qgvA|7e-23|12.8|86/130|c.47.1.8| HM:SCP:REP 2->107|2trcP_|6.3e-40|49.0|104/0|c.47.1.6|1/1|Thioredoxin-like| OP:NHOMO 3017 OP:NHOMOORG 1112 OP:PATTERN ----11232222222211-----325323123-----11----2222223342--------1----22 1123522222222221123-24112122222253331274322222122211343231--3322332545311111111112311222665415221--21132133322111111111111112331332333334223311231556655744442222224441788711111111111122222--221111111121111211111111111111111112222222211111111111111111111112122131113322123223221111111111211111111111111111111111111211111111111222222222232413221221212123232111221112422221-12213222511111323342223233222222222223-243234323421222222222242222322222222223222222223222223211111111111111111111111111111-2333122222222233411123322222223222222211322333433233321116411221111111113233232412232321111132333312454456222111111111122222222221233442212325321222222121222212112111-1222411-11133333333333333233-33333323233333333343334421132233333333333333233333321333333333333111122222222232422111111111111111212121222232222233333333322222222222224333322222222222233433222222223512211111111111121211-11-1-1-111---21-1-1111----------221 2112454-52215554565477586753344335433444234444356698895646744443332223224243332322221233-45554544445125565-3KA98C65774-3237563-74Hd9-569-51153652-633142276744856567554A77499885A66*67869JJLX5OBAB54557 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 92 STR:RPRED 87.6 SQ:SECSTR #############ccccccEEEEEEEcTTcHHHHHHHHHHHHHHHHTTTTcEEEEEETTTcTTHHHHTTcccccEEEEEETTEEEEEEEccccHHHHHHHHHHHc PSIPRED cEEEEcHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHcccccccEEEEEEccEEEEEEEccccHHHHHHHHHHHc //