[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49444.1
DDBJ      :             sodium:dicarboxylate symporter
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  292/915 : Eukaryota  80/199 : Viruses  0/175   --->[See Alignment]
f.49.1
:399 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->318 1xfhA PDBj 2e-18 24.7 %
:RPS:SCOP  43->384 1xfhA  f.49.1.1 * 2e-32 20.3 %
:HMM:SCOP  6->386 2nwwA1 f.49.1.1 * 3.1e-86 32.0 %
:RPS:PFM   37->379 PF00375 * SDF 5e-21 33.5 %
:HMM:PFM   6->384 PF00375 * SDF 5.7e-83 31.0 371/390  
:BLT:SWISS 115->375 EAA2_RAT 1e-17 31.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49444.1 GT:GENE ABO49444.1 GT:PRODUCT sodium:dicarboxylate symporter GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(967134..968333) GB:FROM 967134 GB:TO 968333 GB:DIRECTION - GB:PRODUCT sodium:dicarboxylate symporter GB:NOTE PFAM: sodium:dicarboxylate symporter KEGG: oih:OB2303 sodium:dicarboxylate symporter GB:PROTEIN_ID ABO49444.1 GB:DB_XREF GI:134051473 InterPro:IPR001991 LENGTH 399 SQ:AASEQ MKKVGLLTRLIIGLIFGILVGYVSKEFLQFDALVRLLATFNGIFGGFLSYVIPLIIIGFVAPGIAELGKGAGRLLGITTLFAYVSTVIAGTFAFLVGTGLLPKIVTAVGGHASNPEEALVKGFFQVDMPPIMGVMTALITAFLFGLGMASIKNKSLYQVTKDFQEIIEKVIQSVIIPLLPIHIAGIFANMTYAGEVAKIMKIFGSVFAIVILCHLIMLVFQYVIAGTTTGKNPFTALKNMVPAYLTAIGTQSSAATIPVTLRCAKKNGISDGVADFAIPLCATIHLSGSTITLTMCAMAVMMMGGIDPSFGMMFPFVLMLGVTMVAAPGVPGGAVMAALGLLQSMLGFNEAQLGLMIALYLTQDSFGTACNVTGDGAIALLSNKFAKGSGTVATGVEVA GT:EXON 1|1-399:0| BL:SWS:NREP 1 BL:SWS:REP 115->375|EAA2_RAT|1e-17|31.0|255/573| TM:NTM 9 TM:REGION 4->26| TM:REGION 36->58| TM:REGION 81->103| TM:REGION 129->151| TM:REGION 164->186| TM:REGION 203->225| TM:REGION 239->261| TM:REGION 276->298| TM:REGION 318->340| SEG 5->21|glltrliiglifgilvg| SEG 321->341|gvtmvaapgvpggavmaalgl| BL:PDB:NREP 1 BL:PDB:REP 40->318|1xfhA|2e-18|24.7|279/405| RP:PFM:NREP 1 RP:PFM:REP 37->379|PF00375|5e-21|33.5|328/392|SDF| HM:PFM:NREP 1 HM:PFM:REP 6->384|PF00375|5.7e-83|31.0|371/390|SDF| GO:PFM:NREP 3 GO:PFM GO:0006835|"GO:dicarboxylic acid transport"|PF00375|IPR001991| GO:PFM GO:0016020|"GO:membrane"|PF00375|IPR001991| GO:PFM GO:0017153|"GO:sodium:dicarboxylate symporter activity"|PF00375|IPR001991| RP:SCP:NREP 1 RP:SCP:REP 43->384|1xfhA|2e-32|20.3|340/405|f.49.1.1| HM:SCP:REP 6->386|2nwwA1|3.1e-86|32.0|378/0|f.49.1.1|1/1|Proton glutamate symport protein| OP:NHOMO 765 OP:NHOMOORG 381 OP:PATTERN --2---------------------------1-----------------------1111112------- -----111111111------------------------11------1-------111-------1-1----1-------112---1--1112-2111---11---11-111------12-----2---------1---------------------------------------------------------1-2232322333233322222-13322-24411------1-2--------------1---1-----1-1---1111--2----------11111--------------1111111111111-11111111--23--5555544344-2--433323-51-2---11-1---2--11---21------------------------------------------1---2-1-11--1-111---1-----------------------------2231-11111--------1------2122-1-----------------------------------1---------112------------131111111-1------2-2--1211---2111------------1---212-----1---------1--1---23132-221222334313535525445252---1---------1-1---1----------------------------------11-------------------------------------------1-----1111---21----1---------13333321222-11111--1-1----1---------1---2337444434344411111111111111---4------111-1---11--------------------------------------- ---------------111----------1----------------------1111211----------------------------------1----------------13367553212315288-437H3-532232152134133-321241322413-114---1352552-1-17-----2---1-22-1--1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 279 STR:RPRED 69.9 SQ:SECSTR #######################################HHHHHHHHHHTTHHHHHHHHHHTTccccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccTHHHHGGGccccHTTHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHGGGccHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHTHHHHHHHHHHccHHHHHHHHHHHHHTTTccTTTHHHHcGGGTTTccHHHHHHHHHHHHHHHHHTTccTTTTTTHHHHH################################################################################# DISOP:02AL 1-2,109-116,388-400| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHEEEEHHHccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //