[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49448.1
DDBJ      :             sigma-70 region 4 domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  83/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.13
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   16->116 3dxjF PDBj 8e-11 22.8 %
:RPS:SCOP  54->108 1ku3A  a.4.13.2 * 3e-10 38.2 %
:HMM:SCOP  43->115 1ttyA_ a.4.13.2 * 5.9e-17 42.5 %
:RPS:PFM   39->99 PF07638 * Sigma70_ECF 4e-04 40.4 %
:HMM:PFM   59->108 PF04545 * Sigma70_r4 6.5e-18 54.3 46/50  
:HMM:PFM   30->75 PF09623 * Cas_NE0113 2.6e-05 26.1 46/225  
:BLT:SWISS 1->113 RP28_BACTK 4e-33 61.1 %
:PROS 82->108|PS00716|SIGMA70_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49448.1 GT:GENE ABO49448.1 GT:PRODUCT sigma-70 region 4 domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(972478..972834) GB:FROM 972478 GB:TO 972834 GB:DIRECTION - GB:PRODUCT sigma-70 region 4 domain protein GB:NOTE PFAM: Bacterio-opsin activator, HTH domain protein; sigma-70 region 4 domain protein; Sigma-70, region 4 type 2 KEGG: sth:STH1958 RNA polymerase sigma factor similar to B. subtilis SigK GB:PROTEIN_ID ABO49448.1 GB:DB_XREF GI:134051477 InterPro:IPR000943 InterPro:IPR007050 InterPro:IPR007630 InterPro:IPR013249 LENGTH 118 SQ:AASEQ MHLRFIKKVKAEVSLYDPIGVDKEGNEISLIDILGTDPEVVADTVESTFEKNRLLEKITKLTTREKRVLEMRFGLGTTARKTQREIARTLGISRSYVSRIEKRALNKLTKEFIAEGCQ GT:EXON 1|1-118:0| BL:SWS:NREP 1 BL:SWS:REP 1->113|RP28_BACTK|4e-33|61.1|113/237| PROS 82->108|PS00716|SIGMA70_2|PDOC00592| RP:PDB:NREP 1 RP:PDB:REP 16->116|3dxjF|8e-11|22.8|101/349| RP:PFM:NREP 1 RP:PFM:REP 39->99|PF07638|4e-04|40.4|57/181|Sigma70_ECF| HM:PFM:NREP 2 HM:PFM:REP 59->108|PF04545|6.5e-18|54.3|46/50|Sigma70_r4| HM:PFM:REP 30->75|PF09623|2.6e-05|26.1|46/225|Cas_NE0113| RP:SCP:NREP 1 RP:SCP:REP 54->108|1ku3A|3e-10|38.2|55/61|a.4.13.2| HM:SCP:REP 43->115|1ttyA_|5.9e-17|42.5|73/0|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 167 OP:NHOMOORG 83 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------1-----------------------------------------------------------1---------1------------------------------------21222222222222222222332122222222--------23------------------------------------------------------------------------------------------22222121222122213222222312--2323222232222323332------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 87.3 SQ:SECSTR ###############cTTcccTTcccccGGGTccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHTTTTccTTcHHHHHHHTTcccHHHHHHHHHHHHHHHHHHTTTccHT DISOP:02AL 113-119| PSIPRED ccHHHHHHHcccccccccccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccc //