[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49453.1
DDBJ      :             transcriptional regulator, XRE family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:78 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->56 1b0nA PDBj 8e-07 38.5 %
:RPS:PDB   1->60 3dnvB PDBj 2e-10 23.3 %
:RPS:SCOP  5->72 1x57A1  a.35.1.12 * 3e-10 14.7 %
:HMM:SCOP  3->67 2b5aA1 a.35.1.3 * 1.6e-12 38.5 %
:RPS:PFM   5->59 PF01381 * HTH_3 4e-04 40.0 %
:HMM:PFM   5->59 PF01381 * HTH_3 4.1e-16 41.8 55/55  
:BLT:SWISS 4->78 SLRR_BACSU 1e-08 35.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49453.1 GT:GENE ABO49453.1 GT:PRODUCT transcriptional regulator, XRE family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 977627..977863 GB:FROM 977627 GB:TO 977863 GB:DIRECTION + GB:PRODUCT transcriptional regulator, XRE family GB:NOTE PFAM: helix-turn-helix domain protein KEGG: cpf:CPF_1603 DNA-binding protein GB:PROTEIN_ID ABO49453.1 GB:DB_XREF GI:134051482 InterPro:IPR001387 LENGTH 78 SQ:AASEQ MRNLLKKARIEKGYSVSRFAILLGISESFYYKIEKGVRNPTIELAKKIAILLDKTVDEIFFNPQLDETSIYKILTTGQ GT:EXON 1|1-78:0| BL:SWS:NREP 1 BL:SWS:REP 4->78|SLRR_BACSU|1e-08|35.2|71/152| BL:PDB:NREP 1 BL:PDB:REP 5->56|1b0nA|8e-07|38.5|52/103| RP:PDB:NREP 1 RP:PDB:REP 1->60|3dnvB|2e-10|23.3|60/71| RP:PFM:NREP 1 RP:PFM:REP 5->59|PF01381|4e-04|40.0|55/55|HTH_3| HM:PFM:NREP 1 HM:PFM:REP 5->59|PF01381|4.1e-16|41.8|55/55|HTH_3| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 1 RP:SCP:REP 5->72|1x57A1|3e-10|14.7|68/78|a.35.1.12| HM:SCP:REP 3->67|2b5aA1|1.6e-12|38.5|65/0|a.35.1.3|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 73 STR:RPRED 93.6 SQ:SECSTR HHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHcGGGccHHHHHHHHHHTTccccccccHHHHHHHHHHHc##### DISOP:02AL 1-1,71-71,76-79| PSIPRED cHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHccccccHHHHHHHHHccc //