[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49461.1
DDBJ      :             response regulator receiver protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  485/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:119 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   59->113 2rnjA PDBj 4e-12 56.4 %
:RPS:PDB   58->116 3cloA PDBj 8e-22 44.1 %
:RPS:SCOP  33->83 1qo0D  c.23.1.3 * 2e-04 8.2 %
:RPS:SCOP  58->116 1fseA  a.4.6.2 * 2e-16 42.4 %
:HMM:SCOP  37->116 1p4wA_ a.4.6.2 * 5.9e-21 41.2 %
:RPS:PFM   59->113 PF00196 * GerE 8e-12 61.8 %
:HMM:PFM   57->113 PF00196 * GerE 1e-25 50.9 57/58  
:HMM:PFM   10->50 PF03205 * MobB 0.00011 26.8 41/137  
:BLT:SWISS 41->114 YDFI_BACSU 1e-13 45.9 %
:PROS 73->100|PS00622|HTH_LUXR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49461.1 GT:GENE ABO49461.1 GT:PRODUCT response regulator receiver protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 984152..984511 GB:FROM 984152 GB:TO 984511 GB:DIRECTION + GB:PRODUCT response regulator receiver protein GB:NOTE PFAM: regulatory protein, LuxR KEGG: bce:BC5411 two-component response regulator YhcZ GB:PROTEIN_ID ABO49461.1 GB:DB_XREF GI:134051490 InterPro:IPR000792 LENGTH 119 SQ:AASEQ MDNIGTIIQFGTNDVGINCFCKKVIEEALSQGYRLIVIDSKVEYVKENGKERTSNVNQLTNREFELLKLIAKGISNKAIAKQLFISEKTVKNHLTSIYSKLGVTNRTEATLYAVNNLHL GT:EXON 1|1-119:0| BL:SWS:NREP 1 BL:SWS:REP 41->114|YDFI_BACSU|1e-13|45.9|74/213| PROS 73->100|PS00622|HTH_LUXR_1|PDOC00542| BL:PDB:NREP 1 BL:PDB:REP 59->113|2rnjA|4e-12|56.4|55/67| RP:PDB:NREP 1 RP:PDB:REP 58->116|3cloA|8e-22|44.1|59/249| RP:PFM:NREP 1 RP:PFM:REP 59->113|PF00196|8e-12|61.8|55/57|GerE| HM:PFM:NREP 2 HM:PFM:REP 57->113|PF00196|1e-25|50.9|57/58|GerE| HM:PFM:REP 10->50|PF03205|0.00011|26.8|41/137|MobB| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 2 RP:SCP:REP 33->83|1qo0D|2e-04|8.2|49/189|c.23.1.3| RP:SCP:REP 58->116|1fseA|2e-16|42.4|59/67|a.4.6.2| HM:SCP:REP 37->116|1p4wA_|5.9e-21|41.2|80/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 1046 OP:NHOMOORG 486 OP:PATTERN -------------------------------------------------------------------- 4622B1212211-113322-23113522222233332499334B233-121-4551-1--34A-6858AA21---111-21-6---------------------1-1-----------------------------699A9223D34113111-----1-111-2-3327--------1----55422--12364444446526444444455354752433322222222B5233333333333333322221---22-----11--22211---1111112212222222222222221111111111111112112222114142111121111111--1---3-11-8111-11122125-11111---1-1---------11--------1-1------------21-2121-14--122-22323232-1---------1----------------11---------------------------------1-------1----11----11-1------31-1222-111--2---11111--1-31-1-111--------2--11----1--1111--------1----2-2------------------------------11-12-12-2-2111111211111222112------1------1----2-1111111112-1211111211112221221-1---1111-111111111-1-1111--111---111111111111--------------131111111211111-11111111111-1-------22221-1-3-11----------322123333551442232222222----------------------1--------------------------------------4- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 119 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHTTccEEEEcHHHHHcTHHHHHHHHHHTGGGEEEEEEEEEEEEEEEEcccccHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccHHHHHHHHHHTccc DISOP:02AL 40-60| PSIPRED ccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHccc //