[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49475.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.1.5
:504 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  223->318 1g0dA2  b.1.5.1 * 1e-05 10.4 %
:HMM:PFM   232->291 PF06280 * DUF1034 3.8e-05 27.7 47/112  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49475.1 GT:GENE ABO49475.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 997690..999204 GB:FROM 997690 GB:TO 999204 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: mta:Moth_0321 hypothetical protein GB:PROTEIN_ID ABO49475.1 GB:DB_XREF GI:134051504 LENGTH 504 SQ:AASEQ MKRNTPLLAIMMLVAFFFASITPAALAEEPQQEQLFHRLIISGYYAMYKDGSGNWVAEEFPGQINKVSLGQTRNMLIGQIPCQVKAKGKITRVEVKTIDTITSDIYNEMEANKTTFWRPLSYDGFNKMYLQKKSGQINPGVIILNDQGDVEVTARVLLGPDGNRVHVAQEPDLAQYYANATWAPHSSAVLWTVPVVLEWYGIPIVQELPDFSTKFKQSSFTDITPGQKITTSVTYSLNADHPQAETAKISLKHIINGTAYTVEKLDQAQVTLNPGEVKTVTFTVTASEVDSEIESTIEPLKGIDKNPANNKDKAVISVIKPLPPAGNADLTFSAVSQSKKTPRPAGTAKWTDWVTTTVTIPRPTPPKGTLDWWQVTDCKITYPKKNPEFAFGNPVEPKGTVTAGMSYSSGQFKPSDSKTTASITFQENWSMAGAKIYNILKDELMAASPKHYPISVTYQVKYKYTYTECDEEGNCHKYSDIGYNSKTLNGNILVNGTGVDSRGG GT:EXON 1|1-504:0| TM:NTM 1 TM:REGION 6->28| SEG 354->366|vtttvtiprptpp| SEG 456->467|vtyqvkykytyt| HM:PFM:NREP 1 HM:PFM:REP 232->291|PF06280|3.8e-05|27.7|47/112|DUF1034| RP:SCP:NREP 1 RP:SCP:REP 223->318|1g0dA2|1e-05|10.4|96/109|b.1.5.1| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,337-344,410-420,500-505| PSIPRED cccccHHHHHHHHHHHHHHcccHHHHHccHHHHHHHHHHHHccEEEEEEcccccEEHHHccccccEEEEcccccEEEEEccEEEEcccEEEEEEEEEEEHHHHHHHHHHcccccEEEEEcccccccEEEEEEccccccccEEEEcccccEEEEEEEEEcccccEEEEEccccHHHHHccccccccccEEEEEEHHEEEccccHHHHHcccEEEEEEcccccccccccEEEEEEEEEEccccccccEEEEEEEEEccccccccccccccEEEEccccEEEEEEEEEEcccccEEEEEEEccccccccccccccEEEEEEEcccccccccEEEEEEEcccccccccccccEEEEEEEEEEEcccccccccEEEEEEEEEEEEEccccccccccccccccccEEEEEccccccccccccccEEEEEEEEEcccccccEEEEccccccccccccEEEEEEEEEEEEEEEEEEEcccccEEEEcccccccEEEEEEEEEEccccccccc //