[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49483.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:188 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49483.1 GT:GENE ABO49483.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1004630..1005196 GB:FROM 1004630 GB:TO 1005196 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: mta:Moth_0328 hypothetical protein GB:PROTEIN_ID ABO49483.1 GB:DB_XREF GI:134051512 LENGTH 188 SQ:AASEQ MGTKGRDIAIWGIYFTLPLALVMVKLGYDTLARGVYLLALVSGIWLLYFQFITVPIAIRKSRSSGLKRVVVLPIVRPWANWMIKQHMNADYKKAYEIHIISKPTNLWEFVAALEADLRIIDAKYKDCLFLWETSAPVPSNFRKLIKRHIKVGSAFWQKSGWPIPRPPFVSRQLKRGQVRSGALVWKGE GT:EXON 1|1-188:0| TM:NTM 2 TM:REGION 6->28| TM:REGION 35->57| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,188-189| PSIPRED ccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccccccEEEEEEEEccHHHHHHHHHHccccHHEEEEEEEEccccHHHHHHHHHHHccEEEEccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcccccccEEEEccc //