[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49488.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.85.1
:232 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   32->109 1c89A PDBj 2e-07 12.0 %
:RPS:SCOP  48->108 1vliA1  b.85.1.1 * 8e-08 14.8 %
:HMM:PFM   49->105 PF08666 * SAF 1.2e-05 31.5 54/63  
:HMM:PFM   175->197 PF00666 * Cathelicidins 0.00016 47.8 23/67  
:BLT:SWISS 22->130 FIXA_SHIFL 6e-05 25.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49488.1 GT:GENE ABO49488.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1008950..1009648 GB:FROM 1008950 GB:TO 1009648 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: mta:Moth_0334 Flp pilus assembly CpaB GB:PROTEIN_ID ABO49488.1 GB:DB_XREF GI:134051517 LENGTH 232 SQ:AASEQ MTNLFRKIPIKYIKHFFIMLIVIAVTIPATKYQREWVANNQETISLPVPAHVIYAGHVITPGDITIRKFLKAAQEPTSIQDTTEITGRVAASDLYPMEQIRADKLVPPENILNTGEAYVSIKADSLEQILGGQIQPNMQVDVYHVVDLENAPVLLAKSAIVSGIVGASGSVTPTQNDPPVPKWVLLKVKETECANFTRPVMGGKVFLSQTGYMSTNVSQPTTQTSPQDQVQQ GT:EXON 1|1-232:0| BL:SWS:NREP 1 BL:SWS:REP 22->130|FIXA_SHIFL|6e-05|25.5|106/256| TM:NTM 1 TM:REGION 8->28| SEG 217->231|vsqpttqtspqdqvq| RP:PDB:NREP 1 RP:PDB:REP 32->109|1c89A|2e-07|12.0|75/134| HM:PFM:NREP 2 HM:PFM:REP 49->105|PF08666|1.2e-05|31.5|54/63|SAF| HM:PFM:REP 175->197|PF00666|0.00016|47.8|23/67|Cathelicidins| RP:SCP:NREP 1 RP:SCP:REP 48->108|1vliA1|8e-08|14.8|61/72|b.85.1.1| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 33.2 SQ:SECSTR ###############################cTTTcccccccccccccEcccccccccccTTTcEEEEccccccccccHHH#HHHTTccccccccccEEccTTTccccc########################################################################################################################### DISOP:02AL 1-2,174-176,222-233| PSIPRED ccHHHHHccHHHHHHHHHHHHHHHHccccccccHHHHcccccccEEEEEHHHccccccccHHHEEEEEEEcccccccccccHHHHcEEEEcccccccccccHHHccccccccccccEEEEEEccccHHccccEEccccEEEEEEEEEcccccccccccEEEEEEEcccccccHHccccccccEEEEEEcHHHHHHHHHHHcccEEEEEEEEEEEEEcccccccccHHHHHcc //