Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49492.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:99 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49492.1 GT:GENE ABO49492.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1012892..1013191 GB:FROM 1012892 GB:TO 1013191 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49492.1 GB:DB_XREF GI:134051521 LENGTH 99 SQ:AASEQ MRKTIKNFVNQVKEFWKDDRGTGADTHTTNFLYIVGGIAITSLIIGALGVIISNKTDGISSDIKSFKVTVPSATNGAGTLTNAAPASGNSTVNGITFNK GT:EXON 1|1-99:0| SEG 73->86|atngagtltnaapa| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,99-100| PSIPRED cHHHHHHHHHHHHHHHHHccccccccccccEEEEEHHHHHHHHHHHHHHHHcccccccccccHHEEEEEEccccccccccccccccccccEEccEEEcc //