[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49496.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:444 amino acids
:PSIPRED
:HMM:PFM   138->154 PF01701 * PSI_PsaJ 0.00031 35.3 17/37  
:HMM:PFM   269->326 PF04306 * DUF456 0.00017 35.2 54/140  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49496.1 GT:GENE ABO49496.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1015297..1016631 GB:FROM 1015297 GB:TO 1016631 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: pca:Pcar_1756 hypothetical protein GB:PROTEIN_ID ABO49496.1 GB:DB_XREF GI:134051525 LENGTH 444 SQ:AASEQ MLAGVAAAVPLTSTALFSTDTWWHLATGKWIWENKAIPRNDPFSWSLPGADWTAHEWLFELLLYPFSGTTYGVIIFCAVPVIANIFLFWKLVKRTKPLMTGLILAVSATMLYPGLTARPQLYDYLFFTLMIYLYKENKWLYTIPVVILVWANMHSAVLLGVGLTIFFLVLSLIPSFRVGLIVHEPIGDRNTYFKIAVISILASLCTPWGYNLYGYVWHTISDDIFAKYITEWMSPPLGIPLIKYTTIAVATLVLGGISIYSRSVNLYTVLLCGGLFYLTLSGFRYYTLLGIALTTLLGEIWASDRQNNRGLAAIGVTLGILIGTLVGGIPKDYEQVAMRENYPVAAVNHLGQRTLNPYDWGGYLIFQGQKVFIDGRADIYRFEGDVFQDSMEVLSKLDIQKMIDKYHPDSILCRKESLMTKYLALLPGWVKTYEDNVAVVYKAR GT:EXON 1|1-444:0| TM:NTM 10 TM:REGION 1->21| TM:REGION 63->85| TM:REGION 96->118| TM:REGION 139->161| TM:REGION 165->187| TM:REGION 189->211| TM:REGION 236->258| TM:REGION 260->281| TM:REGION 283->304| TM:REGION 311->333| SEG 287->298|tllgialttllg| SEG 310->329|glaaigvtlgiligtlvggi| HM:PFM:NREP 2 HM:PFM:REP 138->154|PF01701|0.00031|35.3|17/37|PSI_PsaJ| HM:PFM:REP 269->326|PF04306|0.00017|35.2|54/140|DUF456| OP:NHOMO 25 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- -24-------------------------------------------------------------------------------------------------------------------------------------1--11--------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------1--------------------------------1---------1-----------------211-----11------------------1-------------------------------------------------------------------------------------------------------------------1-------------1------------------------------1----------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHcccccccccEEEEEccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccccEEEEccccEEEEcccHHHcccHHHHHHHHHHHccccHHHHHHHcccccEEEcccccHHHHHHHcccEEEEEccccEEEEEEc //