[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49506.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:316 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->313 2fsjA PDBj 5e-12 26.9 %
:RPS:PDB   102->314 3cerC PDBj 1e-04 14.1 %
:RPS:SCOP  161->313 2fsjA1  c.55.1.12 * 2e-17 25.5 %
:HMM:SCOP  2->165 2fsjA2 c.55.1.12 * 6.4e-29 36.7 %
:HMM:SCOP  158->316 2fsjA1 c.55.1.12 * 1.3e-21 33.3 %
:RPS:PFM   64->310 PF06406 * StbA 9e-12 34.9 %
:HMM:PFM   155->216 PF00012 * HSP70 0.00011 29.5 61/602  
:HMM:PFM   239->270 PF01991 * vATP-synt_E 0.00026 40.6 32/198  
:BLT:SWISS 4->313 ACTH_THEAC 1e-11 26.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49506.1 GT:GENE ABO49506.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1026148..1027098 GB:FROM 1026148 GB:TO 1027098 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: mta:Moth_0345 hypothetical protein GB:PROTEIN_ID ABO49506.1 GB:DB_XREF GI:134051535 LENGTH 316 SQ:AASEQ MSKVVAIDFGYREIKGVNSEGLEIKFPTAMAPYVKHPTAEGLEEVVTVTKPGYEPEMYFYGQKALDETGVGFTNDRDKHLHSGHDILMLAAARKLGYENGDTLVVGVPISYADQREALKTQLERLHGDVSVDGGKPKRISFNDVLVLRQGIVVFGLIPDLPNGTLISFDIGEHTTDVSTVKFKNGVIEPNPSKCFSLEYGYSKVVEAIQKEFQSKAGSPVSGEQARAIAEEGYVIYKLKKLDMTLEVLRAKEEIAKNIVKDAKKRLGEIADFAAGFYLCGGGADVLPLKELLPGAVIVDNPQTANARAYLQLAMSE GT:EXON 1|1-316:0| BL:SWS:NREP 1 BL:SWS:REP 4->313|ACTH_THEAC|1e-11|26.9|301/326| BL:PDB:NREP 1 BL:PDB:REP 4->313|2fsjA|5e-12|26.9|297/318| RP:PDB:NREP 1 RP:PDB:REP 102->314|3cerC|1e-04|14.1|206/326| RP:PFM:NREP 1 RP:PFM:REP 64->310|PF06406|9e-12|34.9|235/258|StbA| HM:PFM:NREP 2 HM:PFM:REP 155->216|PF00012|0.00011|29.5|61/602|HSP70| HM:PFM:REP 239->270|PF01991|0.00026|40.6|32/198|vATP-synt_E| RP:SCP:NREP 1 RP:SCP:REP 161->313|2fsjA1|2e-17|25.5|149/161|c.55.1.12| HM:SCP:REP 2->165|2fsjA2|6.4e-29|36.7|158/0|c.55.1.12|1/1|Actin-like ATPase domain| HM:SCP:REP 158->316|2fsjA1|1.3e-21|33.3|156/0|c.55.1.12|1/1|Actin-like ATPase domain| OP:NHOMO 12 OP:NHOMOORG 10 OP:PATTERN --------------------------------------------------------------11---- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1----------------------1-----11212----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 308 STR:RPRED 97.5 SQ:SECSTR ###EEEEEEcccEEEEEcGGGcEEEEEccEEEcccEEEEcccccccccccccTTccEEEEGGGc###cccccccccTTcTTcTTTcHHHHHHHHTTccccEEEEEcHHHHHcTTHHHHHHHHHHHHcccEEccHHHHHHHHHHHHHHHHHHHHccccTTccccEEEEEEEccccEEEEEEcccccccTEcccHHHHHHTcccccccHHHHHHHHHHHHHHHHHHTTTccGGGTcccccHHHHTTcEEEHHHHHHHHHHHTcHHHHTTcTTccTTTTTTHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHH## DISOP:02AL 316-317| PSIPRED cccEEEEEEccccEEEEEEcccEEEEEEEEEccccccccccccccEEEEEcccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHccEEEEccccEEEEEEEEEEEEcccHHHHHccccccccccEEEEEccccEEEEEEEEEcccEEEEccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHccHHHHccccEEcccccHHHHHHHHHHcccc //