[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49524.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   51->101 PF03590 * AsnA 0.00075 20.4 49/244  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49524.1 GT:GENE ABO49524.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1044431..1044775 GB:FROM 1044431 GB:TO 1044775 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49524.1 GB:DB_XREF GI:134051553 LENGTH 114 SQ:AASEQ MLYQLMKKEGGWLVLASQVRYHPELVNFCQVGWTTDLHKWGLIVSLWINPSEWDFNENIPKTDTAIAYLYKHKDGSVYVAKSYEEQVKIHKKYGIPIVDPGEQFHEGDQQLALF GT:EXON 1|1-114:0| HM:PFM:NREP 1 HM:PFM:REP 51->101|PF03590|0.00075|20.4|49/244|AsnA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,3-7| PSIPRED cHHHHHHccccEEEEEEcEEEcHHHHHHHHccccccccccEEEEEEEEcHHHccccccccccccEEEEEEEcccccEEEEccHHHHHHHHHHccccEEccHHHHHcccHHcccc //