Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49528.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:HMM:PFM   1->63 PF10343 * DUF2419 0.00042 30.6 62/287  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49528.1 GT:GENE ABO49528.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1048656..1048931 GB:FROM 1048656 GB:TO 1048931 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49528.1 GB:DB_XREF GI:134051557 LENGTH 91 SQ:AASEQ MGLLNFLFGEPAPRTRRFNVEIELPETQYEALMNMIRAVKEHENKEFDESKFWSKLVTEWLEKNWGPTIKKLANIDKPSRRRTKGSRSTRG GT:EXON 1|1-91:0| SEG 79->90|srrrtkgsrstr| HM:PFM:NREP 1 HM:PFM:REP 1->63|PF10343|0.00042|30.6|62/287|DUF2419| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,75-92| PSIPRED ccHHHHHHcccccccEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccHHHHHHcccccccc //