[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49555.1
DDBJ      :             shikimate kinase
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  779/915 : Eukaryota  46/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:177 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->148 1kagA PDBj 3e-21 39.7 %
:RPS:PDB   4->171 2ax4B PDBj 5e-12 16.4 %
:RPS:SCOP  2->167 1knqA  c.37.1.17 * 1e-16 14.8 %
:HMM:SCOP  1->166 1kagA_ c.37.1.2 * 7e-33 31.9 %
:RPS:PFM   10->150 PF01202 * SKI 2e-29 44.3 %
:HMM:PFM   10->164 PF01202 * SKI 2.7e-45 36.8 155/158  
:BLT:SWISS 1->171 AROK_PELTS 5e-50 55.6 %
:PROS 57->82|PS01128|SHIKIMATE_KINASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49555.1 GT:GENE ABO49555.1 GT:PRODUCT shikimate kinase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1092835..1093368 GB:FROM 1092835 GB:TO 1093368 GB:DIRECTION + GB:PRODUCT shikimate kinase GB:NOTE PFAM: shikimate kinase KEGG: swo:Swol_0528 shikimate kinase GB:PROTEIN_ID ABO49555.1 GB:DB_XREF GI:134051584 InterPro:IPR000623 LENGTH 177 SQ:AASEQ MKNIVLVGFMGSGKSSIGHRLARKLGYQFVDTDYAIEEVTGLTVEQIFAKHGIKRFRGEEVLLVSKLADKEGVVIATGGGLVLNSQNVEKLQQNGIFICLQASPETICKRVKNKRTRPLLARGNLKEKVIKLLQERKDAYDMADLTISTDHLEPDDIVKIIYKFLLERGVIHGNHSG GT:EXON 1|1-177:0| BL:SWS:NREP 1 BL:SWS:REP 1->171|AROK_PELTS|5e-50|55.6|171/172| PROS 57->82|PS01128|SHIKIMATE_KINASE|PDOC00868| BL:PDB:NREP 1 BL:PDB:REP 2->148|1kagA|3e-21|39.7|141/158| RP:PDB:NREP 1 RP:PDB:REP 4->171|2ax4B|5e-12|16.4|165/195| RP:PFM:NREP 1 RP:PFM:REP 10->150|PF01202|2e-29|44.3|140/156|SKI| HM:PFM:NREP 1 HM:PFM:REP 10->164|PF01202|2.7e-45|36.8|155/158|SKI| GO:PFM:NREP 2 GO:PFM GO:0004765|"GO:shikimate kinase activity"|PF01202|IPR000623| GO:PFM GO:0005524|"GO:ATP binding"|PF01202|IPR000623| RP:SCP:NREP 1 RP:SCP:REP 2->167|1knqA|1e-16|14.8|162/171|c.37.1.17| HM:SCP:REP 1->166|1kagA_|7e-33|31.9|166/0|c.37.1.2|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1002 OP:NHOMOORG 833 OP:PATTERN -------------------------------------------21-22-1111--------------- 11111-1111111111111-11111111111111111111211-111-11111-1111-----111-11-11111111222211111111111111-11111111111-1--------------111111111111---111112111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111------1---11----1--1111111111111111111111111111111111111111111---111111111111111111121111111212-11221111121111111111-11111111111111112241112222211111111111-22222222131-1111111111111111112111111121111111111111211-----------------------------11111111112111111111111122111111114223311111211112222221111111111111111111321-2212222212221-212211121-----111-111111111111111111111111111111121111111111111111111111111-1121111111122321222222222222-222222222222222222122222222122222222222222222222222212222222222221111111111211111111111111111111111111111111121111111111111-1111111111111111111111111111111111111111111-1111111----------1---------------------------1--1-1-1111 ---------------1-----------------1---1111-1-----111111--------1--1-1---11-1-------11-1--------1--------111---------------------------------------------------------1-----------11111111112324-4211----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 177 STR:RPRED 100.0 SQ:SECSTR ccEEEEEccTTccHHHHHHHHHHHHHTTTccEEEcHHHHTTTTTTTccccHHHHHHHHHHHHHHHHHHHHTTcEEccccccHHHHHHHHHHHHTTEEEEEEccHHHHHHHcTHTcHHHHHHTTccccHTccTTTccccccccccEEEETTTccHHHHHHHHHHHHHHTTccEEEETT DISOP:02AL 173-178| PSIPRED ccEEEEEccccccHHHHHHHHHHHHccEEEEHHHHHHHHHcccHHHHHHHccHHHHHHHHHHHHHHHHHcccEEEEccccHHccHHHHHHHHHccEEEEEEccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccEEEEcccccHHHHHHHHHHHHHHcccccccccc //