[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49573.1
DDBJ      :             Fimbrial assembly family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:246 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->134 PF05137 * PilN 7e-04 24.4 %
:HMM:PFM   5->121 PF05137 * PilN 6.2e-09 22.8 114/162  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49573.1 GT:GENE ABO49573.1 GT:PRODUCT Fimbrial assembly family protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1112341..1113081 GB:FROM 1112341 GB:TO 1113081 GB:DIRECTION + GB:PRODUCT Fimbrial assembly family protein GB:NOTE PFAM: Fimbrial assembly family protein GB:PROTEIN_ID ABO49573.1 GB:DB_XREF GI:134051602 InterPro:IPR007813 LENGTH 246 SQ:AASEQ MDIRINLLPPEIKHQFEQRKKQQRLMIISAVILAIFVCVMIGLQIGTQKVRSDIAKLQQQKLGLEKQVTLLKPYQELQAKKEKVDKRVRQAMGTSADYTPLLEGIGIYMPPNVWLEEFSVSLEKKNDKNASQNNLMLNKDNEMLDKVNKVADDVVNKGFSNNGDQDKKKAEQLVSYGEVYIRGYALDHFSVANWLKELEKIPQITGIRCQFSSEEETAGELLTTFEIKAALVQPRDTQPSGQRVGE GT:EXON 1|1-246:0| TM:NTM 1 TM:REGION 25->47| SEG 56->67|klqqqklglekq| SEG 145->157|dkvnkvaddvvnk| RP:PFM:NREP 1 RP:PFM:REP 5->134|PF05137|7e-04|24.4|127/162|PilN| HM:PFM:NREP 1 HM:PFM:REP 5->121|PF05137|6.2e-09|22.8|114/162|PilN| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,78-88,123-134,160-170,234-247| PSIPRED ccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccccccccHHHHHHHHHHHHccccccccccEEEcccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHEEEEEEEHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHEEEHHHHccccccccccccccc //