[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49577.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.24.1
:120 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   15->65 1ay2A PDBj 5e-06 41.2 %
:RPS:SCOP  15->45 1ay2A  d.24.1.1 * 1e-05 58.1 %
:HMM:SCOP  14->65 1oqwA_ d.24.1.1 * 6.1e-21 44.2 %
:RPS:PFM   11->101 PF04917 * Shufflon_N 9e-05 26.4 %
:HMM:PFM   12->31 PF07963 * N_methyl 7e-10 55.0 20/20  
:BLT:SWISS 8->62 FMWC_PSEPU 2e-09 47.3 %
:PROS 12->32|PS00409|PROKAR_NTER_METHYL
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49577.1 GT:GENE ABO49577.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1115479..1115841 GB:FROM 1115479 GB:TO 1115841 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: cno:NT01CX_1596 pilin (bacterial filament) subfamily GB:PROTEIN_ID ABO49577.1 GB:DB_XREF GI:134051606 InterPro:IPR001082 InterPro:IPR001120 InterPro:IPR002416 InterPro:IPR012902 LENGTH 120 SQ:AASEQ MLKIAKMLRNRKGFTLVELMVVVAIIGILATIAVPMYNNVTKDAQDAANEATARTLNGAISMYMAKQTSTEVAAFVVKDKAGVLAELVAKGYIQAGADVTNLNFTDGTATPLKAPVYVAP GT:EXON 1|1-120:0| BL:SWS:NREP 1 BL:SWS:REP 8->62|FMWC_PSEPU|2e-09|47.3|55/136| PROS 12->32|PS00409|PROKAR_NTER_METHYL|PDOC00342| TM:NTM 1 TM:REGION 15->37| RP:PDB:NREP 1 RP:PDB:REP 15->65|1ay2A|5e-06|41.2|51/157| RP:PFM:NREP 1 RP:PFM:REP 11->101|PF04917|9e-05|26.4|91/315|Shufflon_N| HM:PFM:NREP 1 HM:PFM:REP 12->31|PF07963|7e-10|55.0|20/20|N_methyl| RP:SCP:NREP 1 RP:SCP:REP 15->45|1ay2A|1e-05|58.1|31/158|d.24.1.1| HM:SCP:REP 14->65|1oqwA_|6.1e-21|44.2|52/144|d.24.1.1|1/1|Pili subunits| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 51 STR:RPRED 42.5 SQ:SECSTR ##############cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHH####################################################### DISOP:02AL 1-2,4-7| PSIPRED ccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHccccEEcccccccccccccccEEccc //