[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49581.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  47/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.70.1
:404 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   64->121 1zkjA PDBj 7e-04 41.4 %
:BLT:PDB   143->319 1quiA PDBj 7e-04 24.9 %
:RPS:PDB   128->366 1c5kA PDBj 7e-04 19.9 %
:HMM:SCOP  30->327 1flgA_ b.70.1.1 * 2.5e-10 28.3 %
:RPS:PFM   231->363 PF05935 * Arylsulfotrans 1e-04 33.9 %
:BLT:SWISS 49->352 DIG1_CAEEL 7e-06 31.8 %
:PROS 31->44|PS01039|SBP_BACTERIAL_3
:TM
:REPEAT 7|36->68|91->123|144->176|196->228|248->280|300->332|352->383
:REPEAT 4|72->90|177->195|229->247|333->351

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49581.1 GT:GENE ABO49581.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1119605..1120819) GB:FROM 1119605 GB:TO 1120819 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: mta:Moth_2145 hypothetical protein GB:PROTEIN_ID ABO49581.1 GB:DB_XREF GI:134051610 InterPro:IPR001638 LENGTH 404 SQ:AASEQ MMLRKIKTRFLILLVSLFLIPFHSLQAWGAGLEIEFEKVAGSSGTDRGTAALQTVDGGYVVVGETMSSYLHGHSKYDAYLLKLDAKGLLKWQKTYGGGSDDRALSIKQTKDDGFILTGVTQSFNQSLDKNVYLVKTDASGQKKWYRTYGGSGDDSGTWVEQTSDGGYIIVGETTSSGAGDKDIYLIKTNDQGQLMWEQTLGGKGSDSGVSVLATKDGGYLLVGQTNSTGAGSFDIYLAKVDGKGKKEWAKTLGGSGLDCVNSLKETTDGGYIIAGESSTYNPTGSDAYLLKIDNAGNLQWEKTYGGNGWAVGKSVQQVPEGGYLLAGWTTAKDRRGFDLYLVKTDEAGKKLWDKTLARDKFDPSFSIQQTNNGIIITGWCIEKMKWTQNRNDDVEVYFMKLKLQ GT:EXON 1|1-404:0| BL:SWS:NREP 1 BL:SWS:REP 49->352|DIG1_CAEEL|7e-06|31.8|267/13100| PROS 31->44|PS01039|SBP_BACTERIAL_3|PDOC00798| TM:NTM 1 TM:REGION 7->29| NREPEAT 2 REPEAT 7|36->68|91->123|144->176|196->228|248->280|300->332|352->383| REPEAT 4|72->90|177->195|229->247|333->351| BL:PDB:NREP 2 BL:PDB:REP 64->121|1zkjA|7e-04|41.4|58/350| BL:PDB:REP 143->319|1quiA|7e-04|24.9|169/321| RP:PDB:NREP 1 RP:PDB:REP 128->366|1c5kA|7e-04|19.9|206/397| RP:PFM:NREP 1 RP:PFM:REP 231->363|PF05935|1e-04|33.9|118/330|Arylsulfotrans| HM:SCP:REP 30->327|1flgA_|2.5e-10|28.3|254/0|b.70.1.1|1/1|Quinoprotein alcohol dehydrogenase-like| OP:NHOMO 132 OP:NHOMOORG 59 OP:PATTERN ----1--------------------------------------1--531-21---1-B2-3---1--- --3--------------------------------------------------------------------------------------------------2--1122----------------------------1------------1----1--1--------2--12-----------------46-------------------------------------------------------------------------------------------------------------------------------------1-------1--1---------------------11-11----1----------------------------------------------------------------------1-1-------------------------------------------------------------------------------------------------------------------------------------1--------------2--1-4------2D-9--------------------2---2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2233------------------------------------2-21112111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 72.5 SQ:SECSTR ###############################################################GGGGGcccEEcTTcHHccEEcHHHHHHHHHHTTTccccHHHHHHHTTcccEEETTEEE######cccEEEEEETTTccEEEEEcccccHEEEEEEEEccTTccEEEETTcEEcTTcccEEEEEETHTTccEEEEEcccccccEEEEEEcTccTccEEEEHHHEEcTTcccEEEEEETTccccEEcHHccccccccEEEEEEEcTTccEEEHHHHHEEEEETTEEEEEEEETTTccEEEcccccccEEEEEcHHHcTTccEEEE###EEEETTEEEEEEEETTcccEEEccccccEEE#EEEEc###################################### DISOP:02AL 1-6| PSIPRED ccccccEEHHHHHHHHHHHHHHHccHHcccccEEEEEEEEcccccEEEEEEEEcccccEEEEEEEcccccccccccEEEEEEEcccccEEEEEEEcccccccEEEEEEEccccEEEEEEEccccccccccEEEEEEcccccEEEEEEEcccccccEEEEEEcccccEEEEEEEccccccccEEEEEEEcccccEEEEEEEcccccccEEEEEEcccccEEEEEEEcccccccccEEEEEEcccccEEEEEEEccccccEEEEEEEcccccEEEEEEEcccccccccEEEEEEcccccEEEEEEcccccccEEEEEEEcccccEEEEEEEccccccccEEEEEEEcccccEEEEEEEccccccEEEEEEEcccccEEEEEEEcccEEEEEccccEEEEEEEEEcc //