[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49590.1
DDBJ      :             copper amine oxidase domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.82.1
:541 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   183->364 1bccA PDBj 7e-04 20.5 %
:RPS:PDB   453->531 1d6uA PDBj 1e-16 29.1 %
:RPS:SCOP  453->529 1d6uA4  d.82.1.1 * 1e-14 28.9 %
:HMM:SCOP  451->535 1oacA4 d.82.1.1 * 1.1e-20 44.7 %
:RPS:PFM   448->532 PF07833 * Cu_amine_oxidN1 4e-18 49.4 %
:HMM:PFM   448->533 PF07833 * Cu_amine_oxidN1 2.8e-27 48.8 86/93  
:HMM:PFM   286->374 PF02530 * Porin_2 0.00016 20.7 87/402  
:BLT:SWISS 183->428 QCR1_MOUSE 7e-06 24.7 %
:BLT:SWISS 453->524 SPI_BRECH 9e-04 31.9 %
:TM
:REPEAT 2|441->477|502->537

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49590.1 GT:GENE ABO49590.1 GT:PRODUCT copper amine oxidase domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1128754..1130379 GB:FROM 1128754 GB:TO 1130379 GB:DIRECTION + GB:PRODUCT copper amine oxidase domain protein GB:NOTE PFAM: copper amine oxidase domain protein KEGG: tte:TTE0524 hypothetical protein GB:PROTEIN_ID ABO49590.1 GB:DB_XREF GI:134051619 InterPro:IPR012854 LENGTH 541 SQ:AASEQ MKKFIVLLLSLVMCFSFIIPAGAEELSQDKKALLDIMNKSFTEMNTEISSTATGSVEYKLNQLGGGFLMMVPELSKLQGAKLGFDYKLNAPAGQMAMQWKINYQGKSYQGDIYLAGSKVIFTKDVFKMVKEIDPTADIPDLNTLPQYLYVDEPELTQLWSSPWLGAKIKDILPLQNELMAFILEGMPNECISNSGNNLRISINQKQFAACLAGLVEKAESEPERFADLMAKYITSLDATQSYDEVKNDILTDIKSEDSEISSADNILKSMEEAGIELKNLDFDTPKGQNGSSKFILNLNIKDTNTASSIGEIKVTVDQVKSGNQIKGNMDFDVKFAVKEQNMNVSFKLAGDYDQSQRDAASDFTLTIDAAQGSTKMFNLGLDILSKAKVDKNVNPAVPQLTKENSLDFSQLTNESDVEEKNLLPGLEPKVNIVLDDIPVDFDVQPLVKDGRTMVPVRTLAEALGCRVNAVNDQEVYLAKGNQYVMMKLGERKYTVNGKTKLLDVPAYVKDGRTLVPLRFIAEELGCQVEADGNMVYITSNE GT:EXON 1|1-541:0| BL:SWS:NREP 2 BL:SWS:REP 183->428|QCR1_MOUSE|7e-06|24.7|223/480| BL:SWS:REP 453->524|SPI_BRECH|9e-04|31.9|72/326| TM:NTM 1 TM:REGION 4->26| NREPEAT 1 REPEAT 2|441->477|502->537| BL:PDB:NREP 1 BL:PDB:REP 183->364|1bccA|7e-04|20.5|176/442| RP:PDB:NREP 1 RP:PDB:REP 453->531|1d6uA|1e-16|29.1|79/717| RP:PFM:NREP 1 RP:PFM:REP 448->532|PF07833|4e-18|49.4|85/91|Cu_amine_oxidN1| HM:PFM:NREP 2 HM:PFM:REP 448->533|PF07833|2.8e-27|48.8|86/93|Cu_amine_oxidN1| HM:PFM:REP 286->374|PF02530|0.00016|20.7|87/402|Porin_2| RP:SCP:NREP 1 RP:SCP:REP 453->529|1d6uA4|1e-14|28.9|76/84|d.82.1.1| HM:SCP:REP 451->535|1oacA4|1.1e-20|44.7|85/86|d.82.1.1|1/1|Copper amine oxidase, domain N| OP:NHOMO 108 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------4---------43-------------------------------------------------------------------------------------------32------------1---------I--4--59--8864-A-4--2-C---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 256 STR:RPRED 47.3 SQ:SECSTR ######################################################################################################################################################################################HHTccccEEEEcccccEEEEEEcccccEEEEEEEccccTTccTTTTTHHHHHHHHH###ccccccccHHHHHHHHHTTTcEEEEEEccccEEEEEEEccccHHHHHHHHHHHHHHccccHHHHHH###HHHHHHHHHHHHHTcHHHHHHHHHHHHHTTTcGGGccccccHHHHHHccHHHHH########################################################################################cEEHHHHHHHHTcEEEETTTTEEEEEETTEEEEEcTTccEEEETTEEEEcccccEEccccEEEcTTHHHHHHTccccccE######### DISOP:02AL 1-1,349-358,541-542| PSIPRED ccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEccccEEEEEEccHHcccccccccEEEEccccccEEEEEEEEEccccEEEEEEEEccEEEEEHHHHHHHHHcccccccccccccccEEEcccHHHHHHHcccccccHHHHHcccHHHHHHHHHccccHHHHcccccEEEEEEcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccEEEcccccccccccccEEEEEEEEEcccccccccEEEEEEEEEEEEccccccccEEEEEEEEEccccEEEEEEccccccccccccccEEEEEEcccccccccHHHHHHcccccccccccccccccccccEEEEEEEEEccccccccEEEEEcccEEEEEccEEEccccccEEEccEEEEEHHHHHHHcccEEEEccccEEEEEEccEEEEEEEccEEEEEccEEEEccccEEEEccEEEEEHHHHHHHHccEEEEcccEEEEEEEc //