[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49594.1
DDBJ      :             putative sporulation protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  77/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:128 amino acids
:PSIPRED
:HMM:PFM   2->58 PF06686 * SpoIIIAC 4.9e-20 35.1 57/58  
:HMM:PFM   70->126 PF06686 * SpoIIIAC 8.4e-24 45.6 57/58  
:BLT:SWISS 1->128 SP3AD_BACSU 2e-35 50.0 %
:TM
:REPEAT 2|3->54|71->123

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49594.1 GT:GENE ABO49594.1 GT:PRODUCT putative sporulation protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1132318..1132704 GB:FROM 1132318 GB:TO 1132704 GB:DIRECTION + GB:PRODUCT putative sporulation protein GB:NOTE KEGG: chy:CHY_2004 putative sporulation protein GB:PROTEIN_ID ABO49594.1 GB:DB_XREF GI:134051623 LENGTH 128 SQ:AASEQ MDILQIVGLGLVVCILAIILRQQKPPMATLLTMTAGIIIFFAMMSQITAVFNVLRDLASQANVSMVYMGTILKIVGIAYIADFGSQICRDAGESALASKIEFAAKIIVLVMAVPIIVAVLQSLIKLVP GT:EXON 1|1-128:0| BL:SWS:NREP 1 BL:SWS:REP 1->128|SP3AD_BACSU|2e-35|50.0|128/133| TM:NTM 4 TM:REGION 1->23| TM:REGION 30->52| TM:REGION 65->87| TM:REGION 104->126| NREPEAT 1 REPEAT 2|3->54|71->123| HM:PFM:NREP 2 HM:PFM:REP 2->58|PF06686|4.9e-20|35.1|57/58|SpoIIIAC| HM:PFM:REP 70->126|PF06686|8.4e-24|45.6|57/58|SpoIIIAC| OP:NHOMO 77 OP:NHOMOORG 77 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111-1--------11------------------------------------------------------------------------------------------111111111111111111111111-1--1111111111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //