[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49600.1
DDBJ      :             biotin carboxylase / acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha
Swiss-Prot:             

Homologs  Archaea  57/68 : Bacteria  867/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
b.84.2c.30.1d.142.1
:448 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->443 2vpqB PDBj e-151 59.0 %
:RPS:PDB   1->445 2c00B PDBj e-112 53.5 %
:RPS:SCOP  1->114 1bncA2  c.30.1.1 * 1e-18 69.3 %
:RPS:SCOP  114->352 1w93A3  d.142.1.2 * 4e-79 38.7 %
:RPS:SCOP  332->445 1bncA1  b.84.2.1 * 7e-45 48.7 %
:HMM:SCOP  1->113 1w96A2 c.30.1.1 * 8e-51 61.9 %
:HMM:SCOP  83->359 1w96A3 d.142.1.2 * 2.3e-79 38.8 %
:HMM:SCOP  331->445 1w96A1 b.84.2.1 * 3.9e-50 51.3 %
:RPS:PFM   3->110 PF00289 * CPSase_L_chain 7e-18 52.0 %
:RPS:PFM   120->321 PF02786 * CPSase_L_D2 8e-56 53.8 %
:RPS:PFM   336->442 PF02785 * Biotin_carb_C 2e-35 60.7 %
:HMM:PFM   116->321 PF02786 * CPSase_L_D2 3.2e-87 50.5 206/211  
:HMM:PFM   1->110 PF00289 * CPSase_L_chain 1.5e-47 61.8 110/110  
:HMM:PFM   336->442 PF02785 * Biotin_carb_C 9.1e-46 50.5 107/107  
:BLT:SWISS 2->442 ACCC_ANASP e-163 63.0 %
:PROS 153->167|PS00866|CPSASE_1
:PROS 286->293|PS00867|CPSASE_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49600.1 GT:GENE ABO49600.1 GT:PRODUCT biotin carboxylase / acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1137958..1139304 GB:FROM 1137958 GB:TO 1139304 GB:DIRECTION + GB:PRODUCT biotin carboxylase / acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha GB:NOTE TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase PFAM: ATP-dependent carboxylate-amine ligase domain protein, ATP-grasp; Carbamoyl-phosphate synthase L chain, ATP-binding; Carbamoyl-phosphate synthetase large chain domain protein; biotin carboxylase domain protein; RimK domain protein ATP-grasp KEGG: dsy:DSY2366 biotin carboxylase GB:PROTEIN_ID ABO49600.1 GB:DB_XREF GI:134051629 InterPro:IPR003135 InterPro:IPR004549 InterPro:IPR005479 InterPro:IPR005481 InterPro:IPR005482 InterPro:IPR011761 InterPro:IPR011764 InterPro:IPR013651 LENGTH 448 SQ:AASEQ MFKKILIANRGEIALRIIRACRELNIKTVMVYSEADRDSLPVRLADEAYCIGPAPSSKSYLNITNIISAAEVSGVDAIHPGYGFLAENANFAEICEDCGIAFIGPSRHAIEFMGNKALARNTMIKANVPVVPGSEGAVSDEEEVIRIAKEIGYPVLIKASAGGGGRGMRVAHSEEDLLKAINTAKNEAQAAFGNGDVYLEKYVEQPRHIEFQILGDKEGNIVYLGERDCSVQRRNQKVIEEAPSVALTPELRRVMGDTAVKAAQAVNYYNAGTVEFLLDKNNNFYFIEMNTRIQVEHPVTELITGIDLIKEQIRIAAGEPLGYGQEDIRIDGWAIECRINAEDPDKNFMPHPGTIKTYHQPGGPGVRLDSAAYNGYAIPPFYDSMIGKLIVWGRDRDEAIRRMQRALDEFVIEGIPTTIPFHKKVLNNAFFRRGEVYTNFIQRRILPD GT:EXON 1|1-448:0| BL:SWS:NREP 1 BL:SWS:REP 2->442|ACCC_ANASP|e-163|63.0|441/447| PROS 153->167|PS00866|CPSASE_1|PDOC00676| PROS 286->293|PS00867|CPSASE_2|PDOC00676| BL:PDB:NREP 1 BL:PDB:REP 3->443|2vpqB|e-151|59.0|441/448| RP:PDB:NREP 1 RP:PDB:REP 1->445|2c00B|e-112|53.5|437/439| RP:PFM:NREP 3 RP:PFM:REP 3->110|PF00289|7e-18|52.0|100/102|CPSase_L_chain| RP:PFM:REP 120->321|PF02786|8e-56|53.8|199/207|CPSase_L_D2| RP:PFM:REP 336->442|PF02785|2e-35|60.7|107/107|Biotin_carb_C| HM:PFM:NREP 3 HM:PFM:REP 116->321|PF02786|3.2e-87|50.5|206/211|CPSase_L_D2| HM:PFM:REP 1->110|PF00289|1.5e-47|61.8|110/110|CPSase_L_chain| HM:PFM:REP 336->442|PF02785|9.1e-46|50.5|107/107|Biotin_carb_C| GO:PFM:NREP 6 GO:PFM GO:0003824|"GO:catalytic activity"|PF00289|IPR005481| GO:PFM GO:0008152|"GO:metabolic process"|PF00289|IPR005481| GO:PFM GO:0003824|"GO:catalytic activity"|PF02786|IPR005479| GO:PFM GO:0005524|"GO:ATP binding"|PF02786|IPR005479| GO:PFM GO:0008152|"GO:metabolic process"|PF02786|IPR005479| GO:PFM GO:0016874|"GO:ligase activity"|PF02785|IPR005482| RP:SCP:NREP 3 RP:SCP:REP 1->114|1bncA2|1e-18|69.3|114/114|c.30.1.1| RP:SCP:REP 114->352|1w93A3|4e-79|38.7|235/267|d.142.1.2| RP:SCP:REP 332->445|1bncA1|7e-45|48.7|113/116|b.84.2.1| HM:SCP:REP 1->113|1w96A2|8e-51|61.9|113/0|c.30.1.1|1/1|PreATP-grasp domain| HM:SCP:REP 83->359|1w96A3|2.3e-79|38.8|263/0|d.142.1.2|1/1|Glutathione synthetase ATP-binding domain-like| HM:SCP:REP 331->445|1w96A1|3.9e-50|51.3|115/0|b.84.2.1|1/1|Rudiment single hybrid motif| OP:NHOMO 4046 OP:NHOMOORG 1118 OP:PATTERN --111222222222221111111221112-122223342222211222222222-1----111---22 2452B43433343366655-562267555555677757CB275543323333746554335552678453423332221223655343223411111--2222433232311111111111111132233233253444652224322232222222111122222322222121222122121222222136544444444444444455555544455555443333336344444444444444444444311133231214411332331323332221122122222222222222222222322222122222222223134222333232444443222232-13213233254322321112-22332755511111466453317586744444444445-44344432456186686567684455444445444446732333333522325561111122211--1111111111111111124644137645333443333333333444413445698622554344347455691143334421111111333645251224432333333343454543655665332323432332313111111124221223243333343143333333333353333442-1223411111123452232222222222-2222222222222222222232444332222222222222222322222222222222222222221233333344442453211111221111211166666434343388873767843443766222222222322222222223222334333333322222231331133--------1-1---------------------------1--11111222 1111345-733-5574676877687886666665547656556777664756965664555564454445637455626654555434-67565445665645AA8-564A567BA946566649C6F5U*C-E9E55556559656546B6385954B8HP4B454F548E8E55364a4347681487476784457 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 448 STR:RPRED 100.0 SQ:SECSTR cccEEEEcccHHHHHHHHHHHHHTTcEEEEEEEGGGTTcGGGGGccEEEEEEcccGGGTTTcHHHHHHHHHHHTccEEEccccTTTTcHHHHHHHHHTTcEEccccHHHHHHHHcHHHHHHHHHHHTcccccccccccccHHHHHHHHHHHcccEEEEETTccEEEEccTTTHHHHHHHHHHHHHHHHHHTcccccEEEEEcccccEEEEEEEEEEccccEEEEEEEEEEEEETTEEEEEEEccccccHHHHHHHHHHHHHHHHHHTcEEEEEEEEEEEETTEEEEEEEEccccTTHHHHHHHHcccHHHHHHHHHTTccccccGGGcccccEEEEEEEEcccTGTTcccccEEccEEEccccTTEEEEEcccTTcEEccccccEEEEEEEEEccHHHHHHHHHHHHHHcEEETccccHHHHHHHTTcHHHHHccccTTHHHHHTTHH PSIPRED cccEEEEEcccHHHHHHHHHHHHcccEEEEEccccccccccHHHccEEEEEcccccccccccHHHHHHHHHHccccEEEcccccccccHHHHHHHHHcccEEEcccHHHHHHHccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHcccEEEEEccccccccEEEEccHHHHHHHHHHHHHHHHHHcccccEEEEEcccccEEEEEEEEEcccccEEEEcccccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEEccccEEEEEEccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccEEEEEEEcccccccccccccEEEEEEEcccccccEEEEEEEEcccccccccccEEEEEEEcccHHHHHHHHHHHHHHEEEEEEcccHHHHHHHHccHHHHcccccHHHHHHHHccc //