[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49613.1
DDBJ      :             1-Deoxy-D-xylulose-5-phosphate synthase
Swiss-Prot:             

Homologs  Archaea  43/68 : Bacteria  868/915 : Eukaryota  181/199 : Viruses  0/175   --->[See Alignment]
c.36.1c.48.1
:635 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->616 2o1xB PDBj e-137 47.3 %
:RPS:PDB   31->624 1ay0A PDBj 3e-87 20.4 %
:RPS:SCOP  13->344 1ni4A  c.36.1.11 * 5e-46 13.9 %
:RPS:SCOP  317->482 1dtwB1  c.36.1.7 * 2e-40 13.9 %
:RPS:SCOP  491->622 1dtwB2  c.48.1.2 * 7e-25 25.0 %
:HMM:SCOP  2->380 1w85A_ c.36.1.11 * 4.3e-92 39.3 %
:HMM:SCOP  290->483 1qgdA1 c.36.1.6 * 8.1e-72 46.5 %
:HMM:SCOP  490->623 1ni4B2 c.48.1.2 * 2.7e-37 47.0 %
:RPS:PFM   32->300 PF00456 * Transketolase_N 3e-16 37.4 %
:RPS:PFM   325->476 PF02779 * Transket_pyr 2e-16 34.2 %
:RPS:PFM   498->612 PF02780 * Transketolase_C 3e-20 45.1 %
:HMM:PFM   318->478 PF02779 * Transket_pyr 2.1e-45 29.4 160/178  
:HMM:PFM   494->616 PF02780 * Transketolase_C 6.2e-37 42.6 122/124  
:HMM:PFM   68->184 PF00456 * Transketolase_N 2.9e-09 35.0 117/333  
:HMM:PFM   247->301 PF00456 * Transketolase_N 0.0004 29.6 54/333  
:HMM:PFM   619->634 PF07601 * DUF1562 0.00092 37.5 16/28  
:BLT:SWISS 7->632 DXS_PELTS 0.0 63.6 %
:PROS 33->52|PS00801|TRANSKETOLASE_1
:PROS 424->440|PS00802|TRANSKETOLASE_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49613.1 GT:GENE ABO49613.1 GT:PRODUCT 1-Deoxy-D-xylulose-5-phosphate synthase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1148880..1150787 GB:FROM 1148880 GB:TO 1150787 GB:DIRECTION + GB:PRODUCT 1-Deoxy-D-xylulose-5-phosphate synthase GB:NOTE TIGRFAM: deoxyxylulose-5-phosphate synthase PFAM: Transketolase, central region; Transketolase domain protein KEGG: mta:Moth_1511 deoxyxylulose-5-phosphate synthase GB:PROTEIN_ID ABO49613.1 GB:DB_XREF GI:134051642 InterPro:IPR005474 InterPro:IPR005475 InterPro:IPR005476 InterPro:IPR005477 LENGTH 635 SQ:AASEQ MEHITSILKNIASPKDLKNLSLKQLQSLALEIRETIIKTVSKTGGHLAPNLGVVELTIALHCVFDTSVDRIIWDVGHQSYVHKLLTGRLAQFSTLRQYGGLSGFPKPEESIHDAFATGHSSTSISAALGMALTRDLKGEKHSVVAVIGDGSLTGGMAFEALNYAGHLKTNMIVVLNDNEMSIAPNVGALSGYLSRLRTDPKYSKGKDEIADLLQKIPHGPKLLKVVDRLKDSVKYLVVPGMLFEELGFTYLGPVDGHDTKAVLTMLQQAKAVSGPVLVHVITKKGKGYLPAEQNPDRYHGVGPFDLETGTVVKSQGPPSYTEVFGETIVKLAKEDDRIIGITAAMPSGTGLNSFAKEFPKRYFDVGIAEQHAVTMAAGMAATGYRPIAAIYSTFLQRAYDQVLHDVCMQNLPVTFALDRGGLVGDDGPTHHGVFDISFLRNIPNLVMMSPKDENELQHMLKTAVTYNGPVAIRYPRGNGIGISMDEKLQCLPIGKGEVIREGNDVLLLAIGNMVQEALKAAESLSAQGIEATVINARYTKPLDEELILNYAGRIKNIVTIEEHVLAGGFGSSILELFESSGLTDVKMKRLGLPDEFIEHGTQNQLRAQYGLTSAGIVDTVLNHHIHKNRTRKEFL GT:EXON 1|1-635:0| BL:SWS:NREP 1 BL:SWS:REP 7->632|DXS_PELTS|0.0|63.6|626/637| PROS 33->52|PS00801|TRANSKETOLASE_1|PDOC00635| PROS 424->440|PS00802|TRANSKETOLASE_2|PDOC00635| SEG 17->30|lknlslkqlqslal| SEG 374->383|tmaagmaatg| BL:PDB:NREP 1 BL:PDB:REP 5->616|2o1xB|e-137|47.3|562/579| RP:PDB:NREP 1 RP:PDB:REP 31->624|1ay0A|3e-87|20.4|579/678| RP:PFM:NREP 3 RP:PFM:REP 32->300|PF00456|3e-16|37.4|222/275|Transketolase_N| RP:PFM:REP 325->476|PF02779|2e-16|34.2|152/172|Transket_pyr| RP:PFM:REP 498->612|PF02780|3e-20|45.1|113/122|Transketolase_C| HM:PFM:NREP 5 HM:PFM:REP 318->478|PF02779|2.1e-45|29.4|160/178|Transket_pyr| HM:PFM:REP 494->616|PF02780|6.2e-37|42.6|122/124|Transketolase_C| HM:PFM:REP 68->184|PF00456|2.9e-09|35.0|117/333|Transketolase_N| HM:PFM:REP 247->301|PF00456|0.0004|29.6|54/333|Transketolase_N| HM:PFM:REP 619->634|PF07601|0.00092|37.5|16/28|DUF1562| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02780|IPR005476| GO:PFM GO:0008152|"GO:metabolic process"|PF02780|IPR005476| RP:SCP:NREP 3 RP:SCP:REP 13->344|1ni4A|5e-46|13.9|323/362|c.36.1.11| RP:SCP:REP 317->482|1dtwB1|2e-40|13.9|165/188|c.36.1.7| RP:SCP:REP 491->622|1dtwB2|7e-25|25.0|128/138|c.48.1.2| HM:SCP:REP 2->380|1w85A_|4.3e-92|39.3|318/0|c.36.1.11|1/1|Thiamin diphosphate-binding fold (THDP-binding)| HM:SCP:REP 290->483|1qgdA1|8.1e-72|46.5|187/195|c.36.1.6|1/1|Thiamin diphosphate-binding fold (THDP-binding)| HM:SCP:REP 490->623|1ni4B2|2.7e-37|47.0|132/138|c.48.1.2|1/1|TK C-terminal domain-like| OP:NHOMO 2502 OP:NHOMOORG 1092 OP:PATTERN 22-1--1133233231-111111-2--1-111---11111111-----------11-1112122--11 235252221111-121122-21114421222141113565234623343223635122112232336542211111114222621132222312111122333433342511121112222222222123222252355222213422211131122212221221333112221231211212312322132455555355355543446554555356624334555435432222222222222222212121-22-31-2222221-2111132222221221333333323233322222212211211112222222222443333333435244422221231-3242222322222224342434331111222111234443233323533333333334-4444464444214331337232642622243333443335555555536623322111121111---11111111111111111224B2322121644354333335547333324335343111111221112133221121111131111111111231133311111231111445343534223222131112111111111111111111322222232212232234222223222221112231--41111--11121333331111111111-1111111111111111113344211113222222222222222111111111122122222222212121111111111131112233121111222333333121113133331222222321221111111111-22121111144144222222222211111132333344--------111-----------1------1-1----2322224232222 23--111-612-1112111111111111111111111111-11111111122221211222212111111-21-1-1-1-21111111-1-1111111-1--111111424584331312234244273Ef4-644131142362-32134222-223423423322622A22524232T2222376E91741221112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 634 STR:RPRED 99.8 SQ:SECSTR GGccccTTcccccGGGcccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHTccccTcEEEEccGGGHHHHHHHTTccccHHHHTcTTccccccccTTcTTcccccccTTHHHHHHHHHHHHHTcccccccEEEEEcHHHHHcHHHHHHHHHHHHTTcTTEEEEEEccEETTEEGGTccccHHHHHHHHTcEEEEEccTTTcHHHHHHHHHHHTTcTTccEEEEEEccTcTTTTcGGGTcccccHHHHHHHHHHTTccTTccccccHHHHHHHHHHTHHHHHHHHHHHHHHcHHHHHHHHHHTTTcEEHHHHHHHHHHHHTTTcTTEEEEEcccHHHHTccGccEETTccEEEccccHHHHHHHHHHHHHHcTTcEEEEEHHHHGGGHHHHHHHHHHTcccEEEEEcccGGGcTTcTTcccccHHHHHTcccccEEEccccHHHHHHHHHHHHHccccEEEEccccEEcccTTccHHHHTTccEEEEccccccEEEEEcTTHHHHHHHHHHHHHHTTccEEEEEcccHHHHHTccHHHHHHHccTEEEEccccccGGGGGTccEEEHHHcTTccccEEEEccccccccccHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHc# DISOP:02AL 1-2,631-636| PSIPRED ccccccHHcccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHccHHHHHHHHHHccccccccccccccEEccccccHHHHHHHHHHHHHHHHcccccEEEEEEccHHHcHHHHHHHHHHHHHHcccEEEEEEccccEEcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccHHHHccccccccccccHHHHHHHHHHHHcccccEEEEEHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHccccEEEccccHHHHHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccHHHccccHHHHHHHHcccEEEEEccHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccEEEccccccEEEEEccHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHcccccccEEEEEccccccccccHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHc //