[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49617.1
DDBJ      :             putative rRNA methylase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  183/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->185 3eeyF PDBj 8e-34 39.3 %
:RPS:PDB   2->185 3eeyA PDBj 4e-20 42.1 %
:RPS:SCOP  15->150 1ixkA  c.66.1.38 * 6e-13 26.7 %
:HMM:SCOP  14->135 2b25A1 c.66.1.13 * 1.3e-17 34.3 %
:RPS:PFM   43->182 PF06962 * rRNA_methylase 2e-40 54.7 %
:HMM:PFM   43->182 PF06962 * rRNA_methylase 9.5e-53 47.5 139/140  
:BLT:SWISS 14->86 MRAW_PHOLL 7e-07 37.9 %
:BLT:SWISS 97->177 MURG_RHISN 2e-04 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49617.1 GT:GENE ABO49617.1 GT:PRODUCT putative rRNA methylase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1153044..1153601 GB:FROM 1153044 GB:TO 1153601 GB:DIRECTION + GB:PRODUCT putative rRNA methylase GB:NOTE PFAM: putative rRNA methylase KEGG: nme:NMB0747 hypothetical protein GB:PROTEIN_ID ABO49617.1 GB:DB_XREF GI:134051646 InterPro:IPR010719 LENGTH 185 SQ:AASEQ MAAKLGHDFLAEILRNGDLAVDGTMGNGHDTLLLAQLVGSQGKVYAFDIQEQAIDNTRQRLVSQNLFDQRVKLIHDGHQNIKHYIEHPIRAAIYNLGYLPGGDHGVITKTETTLIALEHTLNLLSSGGRMVIVVYPGHPGGQQEKEAVEQMVSQLDSLHYKVLKMTLVNRPPSAPGVVLIEKVRE GT:EXON 1|1-185:0| BL:SWS:NREP 2 BL:SWS:REP 14->86|MRAW_PHOLL|7e-07|37.9|66/314| BL:SWS:REP 97->177|MURG_RHISN|2e-04|33.3|81/373| BL:PDB:NREP 1 BL:PDB:REP 7->185|3eeyF|8e-34|39.3|178/190| RP:PDB:NREP 1 RP:PDB:REP 2->185|3eeyA|4e-20|42.1|183/195| RP:PFM:NREP 1 RP:PFM:REP 43->182|PF06962|2e-40|54.7|139/140|rRNA_methylase| HM:PFM:NREP 1 HM:PFM:REP 43->182|PF06962|9.5e-53|47.5|139/140|rRNA_methylase| RP:SCP:NREP 1 RP:SCP:REP 15->150|1ixkA|6e-13|26.7|131/305|c.66.1.38| HM:SCP:REP 14->135|2b25A1|1.3e-17|34.3|108/0|c.66.1.13|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 201 OP:NHOMOORG 198 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------1-1111111-1111111-------------------------------------------------------------------11111111111111111111111111111111111111111111111111111111111111-1--------11----1-1---11111111111111111111111-11111111111111111111111--11-1111111-1-11111111-1111---1-11111-111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111-------------1-11--11111111111---------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------1 ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------111-4-1-111111-11-1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 185 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHHccTTcEEEEcccTTcHHHHHHHHHHcTTcEEEEEcccHHHHHHHHHHHHHHTTcGGGEEEEcccGGGGGGTccccEEEEEEEEcccTTccTTccccHHHHHHHHHHHHHHEEEEEEEEEEEcccTTTccHHHHHHHHHHTTccTTTEEEEEEccTTccccccEEEEEEEccc DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHccccccEEEEccccccccccEEEEccccHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHcccHHHEEEEEEEEccccccccEEEEEEEccc //