[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49618.1
DDBJ      :             transcriptional regulator, ArgR family
Swiss-Prot:ARGR_DESRM   RecName: Full=Arginine repressor;

Homologs  Archaea  0/68 : Bacteria  332/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.74.2
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->149 1f9nC PDBj 5e-29 41.8 %
:RPS:PDB   2->47 2ahqA PDBj 2e-07 26.1 %
:RPS:PDB   87->149 1b4bA PDBj 3e-18 30.2 %
:RPS:SCOP  4->70 1b4aA1  a.4.5.3 * 5e-18 49.3 %
:RPS:SCOP  87->151 1b4bA  d.74.2.1 * 1e-18 30.8 %
:HMM:SCOP  2->77 1f9nA1 a.4.5.3 * 1.2e-22 51.3 %
:HMM:SCOP  80->150 1b4bA_ d.74.2.1 * 2.4e-17 43.7 %
:RPS:PFM   2->66 PF01316 * Arg_repressor 7e-12 56.9 %
:RPS:PFM   88->149 PF02863 * Arg_repressor_C 1e-13 48.4 %
:HMM:PFM   84->149 PF02863 * Arg_repressor_C 3.5e-28 43.9 66/70  
:HMM:PFM   2->63 PF01316 * Arg_repressor 9.7e-26 53.2 62/70  
:BLT:SWISS 1->152 ARGR_DESRM 2e-75 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49618.1 GT:GENE ABO49618.1 GT:PRODUCT transcriptional regulator, ArgR family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1153603..1154061 GB:FROM 1153603 GB:TO 1154061 GB:DIRECTION + GB:PRODUCT transcriptional regulator, ArgR family GB:NOTE PFAM: arginine repressor KEGG: sth:STH1836 transcriptional regulator GB:PROTEIN_ID ABO49618.1 GB:DB_XREF GI:134051647 InterPro:IPR001669 LENGTH 152 SQ:AASEQ MKTQRQAKILELVRERTIETQEELAAALRAEGFEVTQATVSRDIKELSLIKIPGENNTSYYASPGEPMIRRGGEDRLRRLVRLSLSDINSSENLIIIKTPPGEAQGMASAIDHVHWPQIIGTVAGDDTILVIVKPKEATPEVVQRFLELARG GT:EXON 1|1-152:0| SW:ID ARGR_DESRM SW:DE RecName: Full=Arginine repressor; SW:GN Name=argR; OrderedLocusNames=Dred_1083; SW:KW Amino-acid biosynthesis; Arginine biosynthesis; Complete proteome;Cytoplasm; DNA-binding; Repressor; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->152|ARGR_DESRM|2e-75|100.0|152/152| GO:SWS:NREP 6 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0006526|"GO:arginine biosynthetic process"|Arginine biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| SEG 76->86|rlrrlvrlsls| BL:PDB:NREP 1 BL:PDB:REP 2->149|1f9nC|5e-29|41.8|146/148| RP:PDB:NREP 2 RP:PDB:REP 2->47|2ahqA|2e-07|26.1|46/67| RP:PDB:REP 87->149|1b4bA|3e-18|30.2|63/71| RP:PFM:NREP 2 RP:PFM:REP 2->66|PF01316|7e-12|56.9|65/69|Arg_repressor| RP:PFM:REP 88->149|PF02863|1e-13|48.4|62/70|Arg_repressor_C| HM:PFM:NREP 2 HM:PFM:REP 84->149|PF02863|3.5e-28|43.9|66/70|Arg_repressor_C| HM:PFM:REP 2->63|PF01316|9.7e-26|53.2|62/70|Arg_repressor| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01316|IPR001669| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01316|IPR001669| GO:PFM GO:0003700|"GO:transcription factor activity"|PF02863|IPR001669| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF02863|IPR001669| RP:SCP:NREP 2 RP:SCP:REP 4->70|1b4aA1|5e-18|49.3|67/75|a.4.5.3| RP:SCP:REP 87->151|1b4bA|1e-18|30.8|65/72|d.74.2.1| HM:SCP:REP 2->77|1f9nA1|1.2e-22|51.3|76/76|a.4.5.3|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 80->150|1b4bA_|2.4e-17|43.7|71/71|d.74.2.1|1/1|C-terminal domain of arginine repressor| OP:NHOMO 428 OP:NHOMOORG 333 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111---111111--11121121111111111111111-----1111-1------------------------111111-11111-11111-----------------------------------------------1111111-111111112212112221112211221111111111111111111111111111111211113-212212---22222221112-221333222132333333333333222222222222133322233321111111111111111-111221111-1111111111111-1111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-------------------------------1-----1---1111111111111111111-----------------------1-111--------11----1---------------------------------------------------------1111111-1-----1-1----1111111------------------------------1----------------------------------------------------------------------------------------1-111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 149 STR:RPRED 98.0 SQ:SECSTR cHHHHHHHHHHHHHHcccccHHHHHHHHHHTTccccHHHHHHHHHHTTcEEEEcccccEEEEcTTcccccHccHHHHHHHHHHHEEEEEEETTEEEEEEcTTcHHHHHHHHHHHccTTEEEEEEcccEEEEEEccHHHHHHHHHHHHTT### DISOP:02AL 1-3,66-77| PSIPRED ccHHHHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHccEEEEEcccccEEEEEccccccccccHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHcccccEEEEEccccEEEEEEccHHHHHHHHHHHHHHHcc //