[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49622.1
DDBJ      :             CheC, inhibitor of MCP methylation
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  88/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.139.1d.252.1
:333 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   129->189 2f9zB PDBj 7e-04 35.6 %
:RPS:SCOP  29->207 1xkrA  d.252.1.1 * 6e-16 21.6 %
:RPS:SCOP  263->327 1o9yA  b.139.1.1 * 4e-08 30.8 %
:HMM:SCOP  28->220 1xkrA_ d.252.1.1 * 5.4e-42 36.1 %
:HMM:SCOP  254->331 1o6aA_ b.139.1.1 * 5.8e-08 32.1 %
:RPS:PFM   35->71 PF04509 * CheC 1e-06 56.8 %
:RPS:PFM   261->327 PF01052 * SpoA 2e-05 32.8 %
:HMM:PFM   35->65 PF04509 * CheC 5.3e-11 54.8 31/38  
:HMM:PFM   132->166 PF04509 * CheC 3.2e-13 54.3 35/38  
:HMM:PFM   262->329 PF01052 * SpoA 1.8e-14 35.3 68/77  
:BLT:SWISS 1->331 FLIY_BACSU 5e-32 31.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49622.1 GT:GENE ABO49622.1 GT:PRODUCT CheC, inhibitor of MCP methylation GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1158547..1159548 GB:FROM 1158547 GB:TO 1159548 GB:DIRECTION + GB:PRODUCT CheC, inhibitor of MCP methylation GB:NOTE PFAM: surface presentation of antigens (SPOA) protein; CheC domain protein KEGG: chy:CHY_1020 flagellar motor switch protein GB:PROTEIN_ID ABO49622.1 GB:DB_XREF GI:134051651 InterPro:IPR001543 InterPro:IPR007597 LENGTH 333 SQ:AASEQ MSEKVLTQKEIDELFARYEEQPIKQEAKDLLNMQELDIIGEIGNICMGTAATTLSQLLSQRVIIGYPKIIVCQQDEVFGSFSTPYLIIEVQFKEGLNGFNVLVINEEEIAIIADIMMGGNGQVTKPVMITEMELSASTEAMNQMIGSSATAMADLFGIGIDIAPPKATMVEDLLNASHTPLPTDKPVVVARFEITIGDIIKTTFMQITNVDAARDQANYLLMKAGACDAENTEEKASDETVIQNFTQTKAPFDLPNLAGALAIPVDLEFSLGKIRCTAGDLAKLKKGDTLAIPFSSQQIKLLVGGIPVALGELQTHAEETKIKISRLYQKSIK GT:EXON 1|1-333:0| BL:SWS:NREP 1 BL:SWS:REP 1->331|FLIY_BACSU|5e-32|31.0|329/378| SEG 104->121|ineeeiaiiadimmggng| BL:PDB:NREP 1 BL:PDB:REP 129->189|2f9zB|7e-04|35.6|59/190| RP:PFM:NREP 2 RP:PFM:REP 35->71|PF04509|1e-06|56.8|37/38|CheC| RP:PFM:REP 261->327|PF01052|2e-05|32.8|67/77|SpoA| HM:PFM:NREP 3 HM:PFM:REP 35->65|PF04509|5.3e-11|54.8|31/38|CheC| HM:PFM:REP 132->166|PF04509|3.2e-13|54.3|35/38|CheC| HM:PFM:REP 262->329|PF01052|1.8e-14|35.3|68/77|SpoA| RP:SCP:NREP 2 RP:SCP:REP 29->207|1xkrA|6e-16|21.6|171/205|d.252.1.1| RP:SCP:REP 263->327|1o9yA|4e-08|30.8|65/71|b.139.1.1| HM:SCP:REP 28->220|1xkrA_|5.4e-42|36.1|191/0|d.252.1.1|1/1|CheC-like| HM:SCP:REP 254->331|1o6aA_|5.8e-08|32.1|78/87|b.139.1.1|1/1|Surface presentation of antigens (SPOA)| OP:NHOMO 91 OP:NHOMOORG 88 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111------------------------------------------------------------------------------------------1111111111111111-111---111---12-111221111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111--11--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 59 STR:RPRED 17.7 SQ:SECSTR ################################################################################################################################ccHHHHHHHHHHHHHHHHHHHHHHHHHHTccEEEcccE##EEEEEHHHHHHTTcccccEEE################################################################################################################################################ DISOP:02AL 1-2,18-31,119-128,226-257,332-334| PSIPRED cccccccHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEccEEEEEHHHHHHcccccEEEEEEEEcccccEEEEEEEcHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccEEEEEEEcccccccccccccEEEEEEEEEEEcccccccEEEEEcHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHcccEEEEEEEEEEEEccHHHHHccccccEEEEcccccEEEEEEccEEEEEEEEEEEccEEEEEEEEHHHHccc //