[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49631.1
DDBJ      :             small acid-soluble spore protein, alpha/beta type
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->81 2z3xA PDBj 7e-05 39.2 %
:RPS:PFM   26->84 PF00269 * SASP 6e-09 45.8 %
:HMM:PFM   26->84 PF00269 * SASP 1.4e-22 45.8 59/61  
:BLT:SWISS 26->81 SAS2_CLOBI 5e-12 51.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49631.1 GT:GENE ABO49631.1 GT:PRODUCT small acid-soluble spore protein, alpha/beta type GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1168458..1168748 GB:FROM 1168458 GB:TO 1168748 GB:DIRECTION + GB:PRODUCT small acid-soluble spore protein, alpha/beta type GB:NOTE PFAM: small acid-soluble spore protein, alpha/beta type KEGG: sth:STH1431 small acid-soluble spore protein GB:PROTEIN_ID ABO49631.1 GB:DB_XREF GI:134051660 InterPro:IPR001448 LENGTH 96 SQ:AASEQ MSKELTQRDVPYDLIRSTAFSGLVPKELVPYVKPALAEFRNEMAAELGMPDYDKIDKGELPSRRNGEVGGGMTKKMVAFAEAVLAWHYKNRYLITE GT:EXON 1|1-96:0| BL:SWS:NREP 1 BL:SWS:REP 26->81|SAS2_CLOBI|5e-12|51.8|56/64| BL:PDB:NREP 1 BL:PDB:REP 26->81|2z3xA|7e-05|39.2|51/56| RP:PFM:NREP 1 RP:PFM:REP 26->84|PF00269|6e-09|45.8|59/61|SASP| HM:PFM:NREP 1 HM:PFM:REP 26->84|PF00269|1.4e-22|45.8|59/61|SASP| GO:PFM:NREP 2 GO:PFM GO:0003690|"GO:double-stranded DNA binding"|PF00269|IPR001448| GO:PFM GO:0006265|"GO:DNA topological change"|PF00269|IPR001448| OP:NHOMO 25 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-41111111-1--2-----------4---1--22--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 51 STR:RPRED 53.1 SQ:SECSTR #########################ccccGGGHHHHHHHHHHHHHHHTccc#####cTTccHHHHHHHHHHHHHHHHHHHH############### DISOP:02AL 1-6,17-29,96-97| PSIPRED ccHHHHHccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccHHHcccccccHHHHccHHHHHHHHHHHHHHHHHccHHcccEEccc //