[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49635.1
DDBJ      :             phosphopentomutase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  381/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.76.1d.327.1
:397 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->392 2i09B PDBj 1e-91 52.2 %
:RPS:PDB   199->377 3e2dA PDBj 4e-14 7.3 %
:RPS:SCOP  5->117 2i09A1  c.76.1.5 * 2e-36 41.3 %
:RPS:SCOP  103->218 2i09A2  d.327.1.1 * 2e-34 61.1 %
:RPS:SCOP  220->392 2i09A1  c.76.1.5 * 8e-59 46.5 %
:HMM:SCOP  4->392 2i09A1 c.76.1.5 * 3e-73 44.1 %
:RPS:PFM   9->379 PF01676 * Metalloenzyme 7e-26 34.2 %
:HMM:PFM   8->381 PF01676 * Metalloenzyme 1.6e-44 28.3 226/262  
:BLT:SWISS 6->391 DEOB_THETN e-143 63.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49635.1 GT:GENE ABO49635.1 GT:PRODUCT phosphopentomutase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1170986..1172179 GB:FROM 1170986 GB:TO 1172179 GB:DIRECTION + GB:PRODUCT phosphopentomutase GB:NOTE TIGRFAM: phosphopentomutase PFAM: metalloenzyme domain protein; Phosphopentomutase N-terminal domain protein KEGG: tte:TTE0463 Phosphopentomutase GB:PROTEIN_ID ABO49635.1 GB:DB_XREF GI:134051664 InterPro:IPR006124 InterPro:IPR010045 InterPro:IPR013553 LENGTH 397 SQ:AASEQ MTERKVRRVSLIVLDSVGIGELPDAADYGDKGSNTLANVAKAVQGLNLPNLAKLGLGHIHPLQGVEPMTNPLAAYGKMAERSMGKDTTTGHWELAGIILEKPFRTYPQGFPKEIIDKFENRIGRKILGNVVASGTQIIEELGKQHMDTGCPIVYTSADSVFQIAAHEDVIPLEELYRICEIARQMLDGEHKVGRVIARPFVGKPGSFQRTANRHDYAVPPPVPNILTILQEAGIKTMGVGKIYDIFAGVGISDTIKTKDNMDGVDKTIKFMKDTQEGLIFANLVEYDSLYGHRNDPAGYARALEAFDRRLPEIMEAMLPEEVLIITADHGCDPTTTSTDHSREYVPLLVYGEPVKGGVNLGTRTSFSDVAASLADFFGVNLKTGISFVPEILNNPKD GT:EXON 1|1-397:0| BL:SWS:NREP 1 BL:SWS:REP 6->391|DEOB_THETN|e-143|63.1|385/393| BL:PDB:NREP 1 BL:PDB:REP 8->392|2i09B|1e-91|52.2|364/381| RP:PDB:NREP 1 RP:PDB:REP 199->377|3e2dA|4e-14|7.3|178/502| RP:PFM:NREP 1 RP:PFM:REP 9->379|PF01676|7e-26|34.2|351/406|Metalloenzyme| HM:PFM:NREP 1 HM:PFM:REP 8->381|PF01676|1.6e-44|28.3|226/262|Metalloenzyme| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01676|IPR006124| GO:PFM GO:0046872|"GO:metal ion binding"|PF01676|IPR006124| RP:SCP:NREP 3 RP:SCP:REP 5->117|2i09A1|2e-36|41.3|107/283|c.76.1.5| RP:SCP:REP 103->218|2i09A2|2e-34|61.1|95/96|d.327.1.1| RP:SCP:REP 220->392|2i09A1|8e-59|46.5|172/283|c.76.1.5| HM:SCP:REP 4->392|2i09A1|3e-73|44.1|272/0|c.76.1.5|1/1|Alkaline phosphatase-like| OP:NHOMO 434 OP:NHOMOORG 382 OP:PATTERN -------------------------------------------------------------------- --1------------------------------------------------------------------1--------1---1-------------------------------------------------------------1--------------------------------------11111111111111111111111111222211111111111111111111111111111111111111111-2-32-------22221-----1112221111111111111111111111111111111111111111111111-------1-1111111111111-21111111111111121111-11--------------1---------------------1111111111--111111111111-----1111111111-----------------------------------------------------------------------------------------------------------1--------------------1---------------1-1111---------------1-1111111-------111---11-111111111111111111111-------11-11121111112112222222-1222222222122222222111111111111111111111111222222211-211111111111---------1111--11----1----------------------------------------111111111-11121111111111----------------11----------------1------11-11--1111---11----1---11111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 395 STR:RPRED 99.5 SQ:SECSTR #ccccccEEEEEEETTccHHHHHHHHHHHTcTTcccTTGGGccEEEEEEccEEcTTTccEEHHcccccTTcccccTTccccccHHHHHHHTTcEEEEEEETTcHHHHTTTcccccTTcccHHHHHHHcTTTcGGGTccccHHHHHHHHcccEEEEEcTTGGGccccccGGGGGcccccTTcTccHHHHHHHTTcEEEccccccccccccccccGGGTTcccccccccccTHHHHHHHTccccHHHHHHHHHTccGGGccHHHHHHHHHHHccccccHHHHHHHHcEEEcTTccTTcTTTcccEEEcccccGGGcccccTHHHHHHHHHHHHTEEcccccEEcccEEEEEEccHHHHGGcGccEEEHHHHHHHHHHTcTccccccccccHccGGGcc# DISOP:02AL 1-4,394-398| PSIPRED cccccccEEEEEEEccccccccccccHHccccccHHHHHHHHccccccccHHHccHHHHHccccccccccHHHHHHHHHHHHcccccccHHHHHcccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHcHHHHccccEEEEEccccEEEEEcccccccHHHHHHHHHHHHHHHcccccEEEEEEccccccccccEEcccHHHccccccHHHHHHHHHHcccEEEEEEEHHHHccccccccccccccHHHHHHHHHHHHHcccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccEEEEcccccccEEccccccHHHHHHHHHHHccccccccccHHHHHHHcccc //