[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49639.1
DDBJ      :             putative anti-sigma regulatory factor, serine/threonine protein kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  95/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:148 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->138 1tilE PDBj 6e-29 47.0 %
:RPS:PDB   40->134 2btzA PDBj 3e-07 17.9 %
:RPS:SCOP  21->134 1l0oA  d.122.1.3 * 9e-09 46.5 %
:HMM:SCOP  3->136 1l0oA_ d.122.1.3 * 2.2e-17 18.7 %
:RPS:PFM   65->133 PF02518 * HATPase_c 6e-04 34.8 %
:HMM:PFM   42->134 PF02518 * HATPase_c 3.4e-18 28.9 90/111  
:BLT:SWISS 5->136 SP2AB_CLOTE 7e-33 53.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49639.1 GT:GENE ABO49639.1 GT:PRODUCT putative anti-sigma regulatory factor, serine/threonine protein kinase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1175350..1175796 GB:FROM 1175350 GB:TO 1175796 GB:DIRECTION + GB:PRODUCT putative anti-sigma regulatory factor, serine/threonine protein kinase GB:NOTE TIGRFAM: anti-sigma F factor PFAM: ATP-binding region, ATPase domain protein domain protein KEGG: mta:Moth_1497 putative anti-sigma regulatory factor (serine/threonine protein kinase) GB:PROTEIN_ID ABO49639.1 GB:DB_XREF GI:134051668 InterPro:IPR003594 InterPro:IPR010194 LENGTH 148 SQ:AASEQ MKLLNSCSIEFTSIPENVGFARVAIAAFASQLECTLPELEEIKVAVSEAVGNSILHGYRNQQDKKVLVTANIYKEGLEIQVSDEGVGIADINLAMQPAYSTDPERMGLGFVFMQSFSDRMQVDSTPGKGTTVTMFKQIGMRGARVRAN GT:EXON 1|1-148:0| BL:SWS:NREP 1 BL:SWS:REP 5->136|SP2AB_CLOTE|7e-33|53.0|132/141| BL:PDB:NREP 1 BL:PDB:REP 5->138|1tilE|6e-29|47.0|134/140| RP:PDB:NREP 1 RP:PDB:REP 40->134|2btzA|3e-07|17.9|95/357| RP:PFM:NREP 1 RP:PFM:REP 65->133|PF02518|6e-04|34.8|69/112|HATPase_c| HM:PFM:NREP 1 HM:PFM:REP 42->134|PF02518|3.4e-18|28.9|90/111|HATPase_c| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF02518|IPR003594| RP:SCP:NREP 1 RP:SCP:REP 21->134|1l0oA|9e-09|46.5|114/141|d.122.1.3| HM:SCP:REP 3->136|1l0oA_|2.2e-17|18.7|134/141|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 109 OP:NHOMOORG 95 OP:PATTERN -------------------------------------------------------------------- ---------------11-------1----------------------------------------------------------------------------------------------------------------11-------------------------------------------------11-1121111111111111112122221111113211111111111-----------------------------------------------------------------------------------------22211111111111112111111111--1111111211111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 136 STR:RPRED 91.9 SQ:SECSTR ####EEEEEEEEcccTHHHHHHHHHHHHHHEcccccccEHHHHHHHHHHHHHHHHHHHHTTTTccccccEEEEEEEEEEEEEEccccccHHHHHHHcTTTTcccccHHHHHHHHHTTcEEEEEEETTTEEEEEEcEEccc######## DISOP:02AL 1-4,141-149| PSIPRED cccccEEEEEEccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEccEEEEEEEEccccccHHHHHccccccccccccccHHHHHHHHccEEEEEEEccccEEEEEEEEEcccccccccc //