[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49644.1
DDBJ      :             stage V sporulation protein AE, C-terminal region
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:192 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->186 SP5AE_BACSU 6e-40 47.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49644.1 GT:GENE ABO49644.1 GT:PRODUCT stage V sporulation protein AE, C-terminal region GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1178621..1179199 GB:FROM 1178621 GB:TO 1179199 GB:DIRECTION + GB:PRODUCT stage V sporulation protein AE, C-terminal region GB:NOTE KEGG: btl:BALH_3681 stage V sporulation protein AE, C-terminal region GB:PROTEIN_ID ABO49644.1 GB:DB_XREF GI:134051673 LENGTH 192 SQ:AASEQ MNQKRNVILVTDGDQIARRTLEIAAKNVGARCISMSAGNPTRLSGKKMVDLIKSAAHDPVIVMFDDKGAEGQGLGEKAMMEVYNSPDINILGVLAVASNSSCCDGARVDVSITDSGAVVKGPVNKFGRTTKRKELQGDTVEILNDLDVPVVVGIGDIGKMYGADDYHYGAPITTQALLEIIERSGYQWERQP GT:EXON 1|1-192:0| BL:SWS:NREP 1 BL:SWS:REP 1->186|SP5AE_BACSU|6e-40|47.8|186/323| SEG 147->158|dvpvvvgigdig| OP:NHOMO 34 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--1111-11111111111-11111111----------1--------------------------------------------------------------------------------------------1-1---------------------1--1--1---11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,188-193| PSIPRED ccccEEEEEEEcHHHHHHHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHccccEEEEEEEEEEEcccccccEEEEEEEcccccEEEcccccccccccccEEEccEEEEEccccccEEEEEcccHHccccccHHcccHHHHHHHHHHHHHHcccccccc //