[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49653.1
DDBJ      :             Sec-independent protein translocase TatC
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  698/915 : Eukaryota  16/199 : Viruses  0/175   --->[See Alignment]
:258 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   10->219 PF00902 * TatC 3e-30 39.2 %
:HMM:PFM   10->219 PF00902 * TatC 4.1e-67 37.8 209/214  
:HMM:PFM   193->250 PF05661 * DUF808 5.4e-05 25.5 51/295  
:BLT:SWISS 7->241 TATC_CAMJE 7e-39 34.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49653.1 GT:GENE ABO49653.1 GT:PRODUCT Sec-independent protein translocase TatC GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1188196..1188972 GB:FROM 1188196 GB:TO 1188972 GB:DIRECTION + GB:PRODUCT Sec-independent protein translocase TatC GB:NOTE TIGRFAM: Sec-independent protein translocase, TatC subunit PFAM: Sec-independent periplasmic protein translocase KEGG: chy:CHY_0863 sec-independent protein translocase protein TatC GB:PROTEIN_ID ABO49653.1 GB:DB_XREF GI:134051682 InterPro:IPR002033 LENGTH 258 SQ:AASEQ MLEEHDQTMMEHLEELRRVLIISLIATFIMAGVCWFFSDQILEIILQPVLATGNKMHYIGIMEALMTKIKLSVFLGFLTALPIILWQFWSFIMPALRKVEKIYFTIFVIISYVFFIGGILFAFYTVFNIGVKFLLHFGGEELLPMLTIGNYVSFAMMFILPFGVIFELPLAVFLLAQLGVINYQWMVKKRKMAILISVVAGAVLVPSPDIITPLMMATPMYLLFEVGVTIVKVVEWSKKRKAKKQAQEDQIPETEQEE GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 7->241|TATC_CAMJE|7e-39|34.6|234/245| TM:NTM 6 TM:REGION 23->45| TM:REGION 70->92| TM:REGION 108->130| TM:REGION 153->175| TM:REGION 192->214| TM:REGION 216->237| RP:PFM:NREP 1 RP:PFM:REP 10->219|PF00902|3e-30|39.2|209/215|TatC| HM:PFM:NREP 2 HM:PFM:REP 10->219|PF00902|4.1e-67|37.8|209/214|TatC| HM:PFM:REP 193->250|PF05661|5.4e-05|25.5|51/295|DUF808| OP:NHOMO 790 OP:NHOMOORG 738 OP:PATTERN ------11-------111-111-1211212-2------------------222--------111--11 1121111111111111111-111111111111111111111111111111111111111111111111111-------11111111111111-1-----11111112111---------------11111111111111111111111111111111111111111111111-11111-111111111---11211111111111111112221211111121111-11--13111111111111111--------------------------------------1--------------------------1--111-----11--------------------1----1--111111111111------11111111-1111111111111111111111111111-11111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122111111111111111111113111111111111121111-11111111111111111111111111111111111111111212111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11-----11111111111111111111111111111121121211111111122221111---------11111111111111111111111111111111-111111----------------------------------------------111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1-11H111113112-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,236-259| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHccccccccccccccccc //