[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49662.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.93.1
:86 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->71 2ioyA PDBj 1e-04 47.2 %
:RPS:PDB   35->73 1efaB PDBj 5e-06 17.9 %
:RPS:SCOP  35->74 1jx6A  c.93.1.1 * 8e-06 20.0 %
:HMM:SCOP  34->78 1jx6A_ c.93.1.1 * 3.8e-07 37.8 %
:HMM:PFM   5->33 PF00005 * ABC_tran 0.00046 25.0 28/118  
:BLT:SWISS 9->65 ARAG_RHIL3 8e-06 46.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49662.1 GT:GENE ABO49662.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1199814..1200074 GB:FROM 1199814 GB:TO 1200074 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: vei:Veis_2682 periplasmic binding protein/LacI transcriptional regulator GB:PROTEIN_ID ABO49662.1 GB:DB_XREF GI:134051691 LENGTH 86 SQ:AASEQ MMDIVYQHVKKLRVVTPSVKTPVKNLSGGNQQKNDPQLLGKMAVETALGVLEGKKYPKFIDAGTQPITKDNAAQLVNDKLVFAAGK GT:EXON 1|1-86:0| BL:SWS:NREP 1 BL:SWS:REP 9->65|ARAG_RHIL3|8e-06|46.3|54/502| BL:PDB:NREP 1 BL:PDB:REP 36->71|2ioyA|1e-04|47.2|36/274| RP:PDB:NREP 1 RP:PDB:REP 35->73|1efaB|5e-06|17.9|39/330| HM:PFM:NREP 1 HM:PFM:REP 5->33|PF00005|0.00046|25.0|28/118|ABC_tran| RP:SCP:NREP 1 RP:SCP:REP 35->74|1jx6A|8e-06|20.0|40/338|c.93.1.1| HM:SCP:REP 34->78|1jx6A_|3.8e-07|37.8|45/338|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 41 STR:RPRED 47.7 SQ:SECSTR ##################################cHHHHHHHHHHHHHHHHTTcccccEEEEccEEEcccTTccc########### DISOP:02AL 1-1,24-36,86-87| PSIPRED cHHHHHHHHHHHEEEcccccHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccHHHHccccccccccHHHHHccEEEEEccc //