[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49671.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.4.5
:209 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  5->122 1uynX  f.4.5.1 * 2e-05 12.7 %
:RPS:PFM   119->171 PF11167 * DUF2953 1e-06 39.2 %
:HMM:PFM   117->170 PF11167 * DUF2953 3.5e-20 40.4 52/53  
:BLT:SWISS 7->193 YTFI_BACSU 4e-13 26.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49671.1 GT:GENE ABO49671.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1210227..1210856 GB:FROM 1210227 GB:TO 1210856 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: bsu:BG13848 hypothetical protein GB:PROTEIN_ID ABO49671.1 GB:DB_XREF GI:134051700 LENGTH 209 SQ:AASEQ MVLVSHIKVHFKYFRVAEDDTISFEFFLLGFIHYKIEVPVVIFQQKLSGISLTTRTELETGGDHSEELLGKQEKRTISSIGEAKNLCHRWWPFFRAIKPDMDYLLAHLSLERFVWKLRIGTGDAAVTGIITGVAWGIMGSITSLFYKKIATNKPEPELQVEPNFKKEVFSTSIDCIFKIRVVNIMVTGIKILQKKVKRRGVNDVVRTSH GT:EXON 1|1-209:0| BL:SWS:NREP 1 BL:SWS:REP 7->193|YTFI_BACSU|4e-13|26.8|179/100| RP:PFM:NREP 1 RP:PFM:REP 119->171|PF11167|1e-06|39.2|51/53|DUF2953| HM:PFM:NREP 1 HM:PFM:REP 117->170|PF11167|3.5e-20|40.4|52/53|DUF2953| RP:SCP:NREP 1 RP:SCP:REP 5->122|1uynX|2e-05|12.7|118/279|f.4.5.1| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111---1-1----------11-------------------------------------------------------------------------------------------11-----------------------------11111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 57-70,201-210| PSIPRED cEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEEEEEEEEEEEcccccEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccEEEEEEEEEEEEEcHHHHHHHHHHHHHHcccccccccccccc //