[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49672.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  74/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:146 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   33->124 PF09579 * Spore_YtfJ 5e-10 45.7 %
:HMM:PFM   33->124 PF09579 * Spore_YtfJ 5e-32 53.2 79/83  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49672.1 GT:GENE ABO49672.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1210831..1211271 GB:FROM 1210831 GB:TO 1211271 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: mta:Moth_1358 hypothetical protein GB:PROTEIN_ID ABO49672.1 GB:DB_XREF GI:134051701 LENGTH 146 SQ:AASEQ MMLSEHPIEGLMKTAMESIKEMVDVNTVVGDPVETPDGSVIIPVSRVACGFAAGGGEYSAGISAKNNSNGDSVGSPFGGGSGAGVSVQPMGFLVVGNGQIRLLPVDDSHALFDRLIDAAPQMLNQIQNMFNKCDKKNTDSNTQPIV GT:EXON 1|1-146:0| SEG 70->87|gdsvgspfgggsgagvsv| RP:PFM:NREP 1 RP:PFM:REP 33->124|PF09579|5e-10|45.7|81/82|Spore_YtfJ| HM:PFM:NREP 1 HM:PFM:REP 33->124|PF09579|5e-32|53.2|79/83|Spore_YtfJ| OP:NHOMO 110 OP:NHOMOORG 74 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111333333333333333111111333111-1--------11------------------------------------------------------------------------------------------11111111111111111111111-11-----1111111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,57-79,128-143,146-147| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHccccEEcccccEEEEEEEEEEEEccccccccccccccccccccccccccccccccccEEEEEEEEEEccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccHHHcccccccc //